PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G517800.1.p
Common NameSb01g048290, SORBIDRAFT_01g048290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Nin-like
Protein Properties Length: 906aa    MW: 100630 Da    PI: 5.725
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G517800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.72.4e-28599649252
                RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Sobic.001G517800.1.p 599 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 649
                           799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.938588669IPR003035RWP-RK domain
PfamPF020424.3E-26601649IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2406.5E-25817902No hitNo description
SuperFamilySSF542771.82E-22818901No hitNo description
PROSITE profilePS5174521.781820903IPR000270PB1 domain
SMARTSM006665.1E-24820903IPR000270PB1 domain
PfamPF005644.5E-16821902IPR000270PB1 domain
CDDcd064077.48E-40821901No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 906 aa     Download sequence    Send to blast
MEKAPQTDDD GLLACGVMEM DDIAVGDLDL MEELFMAAPG FDFSDFSQPG PGGASPGSCF  60
SPLFDICSTT TTATPPPAPE PAGDDDQAAA APPPRRGWVF QPRHEVEATV KERLRRALER  120
IASLSQTQPG ELLAQVWVPT VIGDRQVLTT CGQPFWLDRR NERLANYRTV SMKYQFSADE  180
TARADLGMPG RVFVGRVPEW TPDVRYFSTE EYPRVRHAQY FDIRGSVALP IFEPRSRACL  240
GVVELVMTTE KVNYNAEIQN ICSALKEVDL RSSDVSSDPR AKVTDTSYRA TIPEIVDVLR  300
TVCETHKLPL AQTWIPCICQ AKRGSRHTDE KLKYCVSTVD EACYVRDLNV KGFHEACSEH  360
HLFRGEGVVG RAFGTNEPCF SEDITTSSKV QYPLSHHAKL FSLRAAVAIR LRSITTGSLD  420
YVLEFFLPVD CIEIEQQRAM LNSLSITIQQ TCYTLRVVSL KELVDEGSIE TSALTPPEYA  480
KTMHENLDEV CSGIDAPART ASLETSEEVS SWIASLVCAQ NKGVKEMDGD LPFGFSKQED  540
EGFSVTAGWH TTPVIGPEGS IFSGIKQHED YKVKEVTCLR DPSSSKLGKT VEKRRTKMEK  600
TVSLEELRKH FAGSLKEAAK NLGVCPTTLK RICRQHGINR WPSRKIKKVG HSLKKLQMVI  660
DSVHGNEGTV QLSSLYENFT KTTWSERELQ GDASYPLSEE KGLLEPSVPD QHCEGRFTSH  720
TSGSNSLSPS CSQSSNSSHG CSSGSKSQQH GSASQLAVKK EVFMEENQSS TLLKAASHAE  780
LQMCPEERPV TLPRSHSQML LSEQKPVENM TGMQMSKPDS LKIKAMYGEE RCIFRLQPSW  840
GFEKLKEEIL KRFGVAQEMH VDLKYLDDES EWVLLTCDAD LLECIDVYKS SNTQTVRISV  900
HSNGQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.48030.0embryo| leaf| ovary
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G517800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465923.10.0protein NLP1
RefseqXP_021317584.10.0protein NLP1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLC5WZW20.0C5WZW2_SORBI; Uncharacterized protein
STRINGSb01g048290.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]