PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G489900.1.p
Common NameDof23, Sb01g045840, SORBIDRAFT_01g045840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 425aa    MW: 45170.8 Da    PI: 8.4221
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G489900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.48.6e-4094154262
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k++s
  Sobic.001G489900.1.p  94 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSAS 154
                           7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2790143IPR003851Zinc finger, Dof-type
PfamPF027012.7E-3296152IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.92998152IPR003851Zinc finger, Dof-type
PROSITE patternPS013610100136IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MGEGRAGDGL IKLFGKTIPV PETPAAGDAA KDIQQSGSSG TTDLKGQENT LQDSTGSPPQ  60
QEVADTEDSS AAKNSSADKQ QGEAANQKEK LKKPDKILPC PRCNSMDTKF CYYNNYNINQ  120
PRHFCKNCQR YWTAGGAMRN VPVGAGRRKS KSASAASHFL QRVRAALPMD PLCTAAKTNG  180
TVLSFGSDMS SLDLTEQMKH LKEKLIPIAG IKNGDERSVG SCTEGPAKAE DSNQKENVTA  240
EKSAKLVQHP CMNGVAMWPF SCAPPPACYT PGSIAIPFYP APAAYWGCMV PGAWNAPWPP  300
QSPSETGSTL STASPASTKS NCFTPGKRPR DCNEEGDTKG NGKVWVPKTI RIDDVDEVAR  360
SSILSLIGIN GDKAGKDGKG CKLARVFEQK EEARTATHSV INGLPFLQGN PAALSRSLTF  420
QEGS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.6670.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G489900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1693750.0AC169375.4 Sorghum bicolor clone SB_BBc0020O07, complete sequence.
GenBankHQ5400860.0HQ540086.1 Sorghum bicolor clone SbDof23 Dof-type zinc finger protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468428.10.0cyclic dof factor 1 isoform X1
TrEMBLC5WWR60.0C5WWR6_SORBI; Dof-type zinc finger protein
STRINGSb01g045840.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-50cycling DOF factor 2
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]
  2. Kushwaha H, et al.
    Cloning, in silico characterization and prediction of three dimensional structure of SbDof1, SbDof19, SbDof23 and SbDof24 proteins from Sorghum [Sorghum bicolor (L.) Moench].
    Mol. Biotechnol., 2013. 54(1): p. 1-12
    [PMID:22476870]