PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G476300.1.p
Common NameSb01g044620, SORBIDRAFT_01g044620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 325aa    MW: 35365.9 Da    PI: 4.5553
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G476300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61.1e-1871123456
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           ++++ +eq+++Le++Fe +++++ ++++++A+ l L+ rqV vWFqNrRa++k
  Sobic.001G476300.1.p  71 KRRLLQEQVRALERCFETDNKLDPDRKARIARDLALQPRQVAVWFQNRRARWK 123
                           456789**********************************************9 PP

2HD-ZIP_I/II123.41.1e-3969161193
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           ekkrrl +eqv++LE++Fe+++kL+p+rK+++ar+L lqprqvavWFqnrRAR+ktk lE+d++aL++++dal+++ ++L++++++L++
  Sobic.001G476300.1.p  69 EKKRRLLQEQVRALERCFETDNKLDPDRKARIARDLALQPRQVAVWFQNRRARWKTKTLERDFSALRARHDALRADCDALRRDKDALAA 157
                           69**************************************************************************************9 PP

           HD-ZIP_I/II  90 elke 93 
                           e++e
  Sobic.001G476300.1.p 158 EIRE 161
                           9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-1764125IPR009057Homeodomain-like
SMARTSM003892.6E-1768129IPR001356Homeobox domain
PROSITE profilePS5007115.93769125IPR001356Homeobox domain
CDDcd000863.77E-1670125No hitNo description
PfamPF000466.2E-1671123IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.6E-1976124IPR009057Homeodomain-like
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PfamPF021832.7E-13125166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MRRQSKRPTA SRESPETVEK LAFAEEEALT AGKMEPDEGE MDVDVDDEEE DELAGGRGAA  60
RSSPCGLGEK KRRLLQEQVR ALERCFETDN KLDPDRKARI ARDLALQPRQ VAVWFQNRRA  120
RWKTKTLERD FSALRARHDA LRADCDALRR DKDALAAEIR ELRQKLLSKA PEAAVKLEAT  180
TGNDAAEERQ TTAGAPPAGV CKDGSSDSDS SVVFNDVETS PYSGAAAFEQ PAFVGFDAPF  240
LDTSAAAPTG CSSPPVFEPK WQHGPTTYPF DSYKTCAGGG YGFTEEWLAS SDVIGNDGAA  300
GFFSEDHASS LNFSWCASGV QGWE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.91050.0panicle| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G476300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699250.0JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465732.10.0homeobox-leucine zipper protein HOX13 isoform X2
SwissprotQ10QP31e-106HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLC5WUU60.0C5WUU6_SORBI; Uncharacterized protein
STRINGSb01g044620.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Representative plantOGRP1414944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.24e-28homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]