PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G472600.1.p
Common NameSb01g044280, SORBIDRAFT_01g044280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 537aa    MW: 59778.3 Da    PI: 6.2552
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G472600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS411.58e-1261655351373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++l+++c +av++ ++   +al+++l+ ++s +g+pmqRl ay++e+L arl+ +++ lyk+l+++e    +sse +++++l++e++P
  Sobic.001G472600.1.p 165 LRQLIIACGKAVDE-NAFYMDALMSELRPMVSVSGEPMQRLGAYMLEGLIARLSFTGHALYKSLKCKEPV-ATSSELMSYMHLLYEICP 251
                           6899********98.667889***********************************************97.789999************ PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           ++kf+++ aN aI +av+ge+ +HiiDf+i qG QW+++++aLasRp+  p lRiTg+++++s   +   l  +g+rL+ +A+++g+pf
  Sobic.001G472600.1.p 252 FFKFGYMSANGAIADAVKGEDIIHIIDFQIAQGSQWMTMIHALASRPGRRPYLRITGIDDSNSAhaRGGGLDMVGQRLHTVAQSCGLPF 340
                           ************************************************************8888889999******************* PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           efn+ v  + +++ +e+L v+pgEa++Vn+++qlh+++desv +e++rd++L++vkslsP+vv++veqea++n+++F+ r +e+l+yy+
  Sobic.001G472600.1.p 341 EFNA-VPAASHEVVFEDLCVRPGEAIVVNFAYQLHHTPDESVGTENHRDRILRMVKSLSPRVVTLVEQEANTNTAPFFLRYMETLDYYT 428
                           ****.688899999*************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           a+f+++++  pr++++ri+ E+++++r+ivn++aceg+er+erhe ++kWr+rl +aGF+p+pls  ++ ++k+ll  ++s  yr+ee+
  Sobic.001G472600.1.p 429 AMFEAIDVACPRDDKKRISTEQHCVARDIVNLIACEGTERIERHEPFGKWRARLAMAGFRPYPLSPVVNRTIKTLLDSYHSY-YRLEER 516
                           ********************************************************************************66.****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaW 373
                           +g l+lgWk+r+Lv+ SaW
  Sobic.001G472600.1.p 517 DGILYLGWKNRKLVVSSAW 535
                           ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.754139517IPR005202Transcription factor GRAS
PfamPF035142.8E-123165535IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MSTQASNRSY RYPDNTQLLY HNGNPMHVGG NGNYYVQQNH DDVNYISSDD GSQSSNSRAQ  60
GFQAQFCTLD SSSANCVYPA HSSTSSQSIS GSPLSQQESH SDHAYGSSPS ASCITQVPTW  120
TLKDLENVML GPDSDICSPD SSFLPGTALH ENNWRELLGI QTGDLRQLII ACGKAVDENA  180
FYMDALMSEL RPMVSVSGEP MQRLGAYMLE GLIARLSFTG HALYKSLKCK EPVATSSELM  240
SYMHLLYEIC PFFKFGYMSA NGAIADAVKG EDIIHIIDFQ IAQGSQWMTM IHALASRPGR  300
RPYLRITGID DSNSAHARGG GLDMVGQRLH TVAQSCGLPF EFNAVPAASH EVVFEDLCVR  360
PGEAIVVNFA YQLHHTPDES VGTENHRDRI LRMVKSLSPR VVTLVEQEAN TNTAPFFLRY  420
METLDYYTAM FEAIDVACPR DDKKRISTEQ HCVARDIVNL IACEGTERIE RHEPFGKWRA  480
RLAMAGFRPY PLSPVVNRTI KTLLDSYHSY YRLEERDGIL YLGWKNRKLV VSSAWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-581675356374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.20470.0leaf| root
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G472600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0672840.0BT067284.1 Zea mays full-length cDNA clone ZM_BFb0379I09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468350.10.0scarecrow-like protein 21
RefseqXP_021306782.10.0scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLC5WUR20.0C5WUR2_SORBI; Uncharacterized protein
STRINGSb01g044280.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Representative plantOGRP14091447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  3. Tanabe S, et al.
    The elicitor-responsive gene for a GRAS family protein, CIGR2, suppresses cell death in rice inoculated with rice blast fungus via activation of a heat shock transcription factor, OsHsf23.
    Biosci. Biotechnol. Biochem., 2016. 80(1): p. 145-51
    [PMID:26287768]