PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G421900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 735aa    MW: 82673.4 Da    PI: 6.4655
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G421900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS387.12.1e-1183597301374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++ L++cA+av+++d + a++lL+++++++ p+gd  qRla++f+ +L+arla+++s+ly++l +++t+    s+ l+a++l+  ++P
  Sobic.001G421900.1.p 359 LRTILIHCAQAVAADDRRTANELLKQIRHHSKPNGDGSQRLAHCFADGLEARLAGTGSQLYRKLIAKRTT---ASDMLKAYHLYLAACP 444
                           5789************************************************************999998...89************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           + ++sh++ Nq+Il  ++++++vHiiDf+i  G+QWp+L++ L++R++gpp lR+Tg++ p++g   +e++eetg+rLa++A++++vpf
  Sobic.001G421900.1.p 445 FKRLSHFLSNQTILSMIKNASKVHIIDFGIYFGFQWPCLIRRLSKREGGPPVLRVTGIDVPQPGfrPSERIEETGQRLAEYAAKFKVPF 533
                           ***************************************************************9************************* PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           e++  +a+++e++++e+L+v ++E+++Vn+ ++  +l de+v+++s+r++vL+++++++P ++++   + +++ + F +rf eal ++s
  Sobic.001G421900.1.p 534 EYQG-IASKWETIRVEDLKVGKDEVVIVNCLYRFRNLIDETVAVDSPRNRVLNTIRQVNPAIFIHGIVNGSYSVPFFITRFREALFHFS 621
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           alfd+le+++pr++ +r+ +Ere++gre+ nv+aceg++r+er et+++W+ r  +aGF + pl+++++++ak  ++ ++ + + ++e+
  Sobic.001G421900.1.p 622 ALFDMLETTVPRDDPQRALIEREMFGREALNVIACEGSDRVERPETYKQWQVRNLRAGFVQSPLNKEIVMKAKDKVKDIYHKDFVIDED 710
                           ********************************************************************************888****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                           sg+l++gWk+r ++++S W+
  Sobic.001G421900.1.p 711 SGWLLQGWKGRIIYAISTWK 730
                           *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.237333710IPR005202Transcription factor GRAS
PfamPF035147.1E-116359730IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MGLDNTYGEL SGMFCGGLSY DGYIDHSSGS DYFRFTDPLP VVVPQMTAEA CSNPSSTVSR  60
ANTETDNPED WEFISDESLN YISRMLMEED IDEKVSMYQA ESAALRAAAK PFYDILGHKF  120
PPSPDHQPIP WSMDSPSESS SSICTQSIAS SVTSSSIGGT VDSNWRYDVG RSEQLEAYQG  180
LCGQSSQPLV GTSSDASNAV DGLDDPLITN GQIPEYLFES LPTWDFRRGI EEAQKFLPVS  240
NTLVIDLEAG GITRPQEARK DVSLNAKKAD VLKAKKNRQS EDLDLIEGRN FKQSAFSSDE  300
PDWIEMFDDL LRQTEKKATD LRELMRNEAS KNSQVTQTKG PSGPRPRGRK PTKKDVVDLR  360
TILIHCAQAV AADDRRTANE LLKQIRHHSK PNGDGSQRLA HCFADGLEAR LAGTGSQLYR  420
KLIAKRTTAS DMLKAYHLYL AACPFKRLSH FLSNQTILSM IKNASKVHII DFGIYFGFQW  480
PCLIRRLSKR EGGPPVLRVT GIDVPQPGFR PSERIEETGQ RLAEYAAKFK VPFEYQGIAS  540
KWETIRVEDL KVGKDEVVIV NCLYRFRNLI DETVAVDSPR NRVLNTIRQV NPAIFIHGIV  600
NGSYSVPFFI TRFREALFHF SALFDMLETT VPRDDPQRAL IEREMFGREA LNVIACEGSD  660
RVERPETYKQ WQVRNLRAGF VQSPLNKEIV MKAKDKVKDI YHKDFVIDED SGWLLQGWKG  720
RIIYAISTWK PKNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-503637308375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.103720.0embryo| ovary
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G421900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279710.0KJ727971.1 Zea mays clone pUT6085 GRAS transcription factor (GRAS67) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021302063.10.0scarecrow-like protein 9
RefseqXP_021302066.10.0scarecrow-like protein 9
RefseqXP_021302069.10.0scarecrow-like protein 9
TrEMBLA0A1Z5SAG30.0A0A1Z5SAG3_SORBI; Uncharacterized protein
STRINGSb01g039670.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein