PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G420300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 395aa    MW: 40285.8 Da    PI: 10.3632
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G420300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.8e-3988148262
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           +e alkcprC+stntkfCyynnyslsqPr+fCk+CrryWt+GG+lrnvPvGgg+r+nk+ss
  Sobic.001G420300.1.p  88 PEPALKCPRCESTNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGSLRNVPVGGGCRRNKRSS 148
                           67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3672146IPR003851Zinc finger, Dof-type
PfamPF027017.9E-3391146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.62792146IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MVFPSPSVPV YLDPHPPNWN NQQQGQQPRA SGGADAPLLP VGPAAATAAA PEPSGLPRSS  60
SAASAAVAAH ARPNSMAERA RLARMPQPEP ALKCPRCEST NTKFCYYNNY SLSQPRHFCK  120
TCRRYWTRGG SLRNVPVGGG CRRNKRSSKS SSAAAAGSSS SSKTSSSGRL LGGPSATPST  180
TPGVTGAIIT PGLSSFSHHH LPFLGSMHPP GPNLGLAFSA GLPLLGMQHL DTVDQFPVAS  240
GGGTTIGASL EQWRVQQQQQ RQFPFMTGGI LDLPQPPTYQ LGLEANRGGG GGSAAAAFTL  300
GQPTTTSATA TTGRQEGSPK KMEDSKGQDM SLQRQYMAAL RHGSGAHGGW DGNAAGGSGS  360
DGGGTGSAGS TWPMNIIPGF HSSSTTGGNG GGSL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G420300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824000.0KC582400.1 Sorghum bicolor dof3 protein (dof3) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021310104.10.0dof zinc finger protein DOF3.6 isoform X2
TrEMBLA0A1B6QP240.0A0A1B6QP24_SORBI; Uncharacterized protein
STRINGSb01g039550.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.36e-42OBF-binding protein 3