PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G409200.1.p
Common NameSb01g038650, SORBIDRAFT_01g038650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 236aa    MW: 25059.3 Da    PI: 6.8668
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G409200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.47.9e-41601591100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++kll++lpe+ r da+ss+vyeAear+rdPvyG++g + +lq+q ++
  Sobic.001G409200.1.p  60 PCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNIIKLLQDLPESSRADAVSSMVYEAEARLRDPVYGCAGAVCRLQKQANE 148
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           lk++la++++ 
  Sobic.001G409200.1.p 149 LKVQLARAQAD 159
                           ******99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1014475.23E-53443No hitNo description
PROSITE profilePS5089125.46359160IPR004883Lateral organ boundaries, LOB
PfamPF031955.5E-4160157IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MDYGNASTGS TAAPEQYNYC RSVSPPSRVS SCSPPPPPPP PPPAVLQVVG NVPPTVVLSP  60
CAACKILRRR CADGCVLAPY FPPTEPAKFT TAHRVFGASN IIKLLQDLPE SSRADAVSSM  120
VYEAEARLRD PVYGCAGAVC RLQKQANELK VQLARAQADL LNAQAQHANL LALFCVEMAN  180
RRGGNQQQHP SSPLTTTMDG GGGSSGLFGA AYQQTFYDSD LDSATWPDHE AQLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-415916210113LOB family transfactor Ramosa2.1
5ly0_B4e-415916210113LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.86381e-91leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G409200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9539370.0EU953937.1 Zea mays clone 1449845 LOB domain protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465424.11e-174LOB domain-containing protein 1
SwissprotQ9LQR07e-63LBD1_ARATH; LOB domain-containing protein 1
TrEMBLC5WNK81e-172C5WNK8_SORBI; Uncharacterized protein
STRINGSb01g038650.11e-173(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-55LOB domain-containing protein 1