PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G340200.1.p
Common NameSb01g032710, SORBIDRAFT_01g032710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NF-YA
Protein Properties Length: 310aa    MW: 33887.8 Da    PI: 10.1352
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G340200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1041.3e-32148204158
             CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R Rg+gGrF
  Sobic.001G340200.1.p 148 EEPIFVNAKQYNAILRRRQIRAKLEAQNKL-VKGRKPYLHESRHRHAMKRVRGPGGRF 204
                           69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.9E-36146207IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.658147207IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.0E-27149204IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.1E-23150172IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860152172IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.1E-23181204IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MLLREMDGDP FHPMPNYDFL SGNGYSLKQL VRSNSDIDSS SSKSEQSRQD LSDSSLNGQR  60
TPTQSDNNDI CGKRDQGMVK SLLSFGSPEA AFSPHKFDYS QSFACASYTA DPYHGGVLAG  120
YTSNGSVHPQ INGAANTRVP LPVGPAAEEP IFVNAKQYNA ILRRRQIRAK LEAQNKLVKG  180
RKPYLHESRH RHAMKRVRGP GGRFLNKKEL QEQQQQQQKA LPSLQTPTGR VSISKMAFGR  240
DLCTESSTSH SPSTSSGISS VSNGSGMLAH QEHISFASAN FLPSMNFRVE NGGEKMAVNG  300
VRHHTPVVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-22148209263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188197RHRHAMKRVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9618650.0EU961865.1 Zea mays clone 238735 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467701.10.0hypothetical protein SORBIDRAFT_01g032710
TrEMBLC5WWM80.0C5WWM8_SORBI; Putative uncharacterized protein Sb01g032710
STRINGSb01g032710.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Representative plantOGRP6801672
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.12e-35nuclear factor Y, subunit A3