PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G327900.2.p
Common NameSb01g031720, SORBIDRAFT_01g031720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 665aa    MW: 70398 Da    PI: 6.538
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G327900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS84.91.3e-262383442108
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.fsevsP 89 
                            +lLlecA+av+++d +++q+l++ l+elasp+gd  q+la+yf+++L arl+ s++++ ++l++ ++++ +s e++  + l f+e+sP
  Sobic.001G327900.2.p 238 AQLLLECARAVAARDSQRVQQLMWMLNELASPYGDVDQKLASYFLQGLFARLTTSGPRTLRTLAAASDRN-TSFESTRRTALrFQELSP 325
                           589************************************************************9888874.444444444446****** PP

                  GRAS  90 ilkfshltaNqaIleaveg 108
                           +  f+h++aN aIlea+ +
  Sobic.001G327900.2.p 326 WASFGHVAANGAILEAFLE 344
                           ****************965 PP

2GRAS216.41.5e-66368663110374
                  GRAS 110 ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvak.rledlele 192
                            r+Hi+D++ + ++QWp+Ll+aLa+R+ +++p+l iT+v++ ++      ++ ++e+++rL+kfA+ +gvpf f+++++  +l++l+l+
  Sobic.001G327900.2.p 368 PRLHILDLSNTFCTQWPTLLEALATRSsDDTPHLSITTVVPTAAPgsaaAQRVMREIAQRLEKFARLMGVPFTFRAVHHAgDLAELDLD 456
                           799************************8889********9966558899999************************97767******** PP

                  GRAS 193 eLrvkp......gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse..................sFlerf 257
                            L++++        ala+n+v +l  +   ++  +  rd+++  +++l+P+vv+vve++ad+ ++                   F++ f
  Sobic.001G327900.2.p 457 GLDLRRegeggaTTALAINCVNALRGVA--PGGARR-RDAFVASLRRLEPRVVTVVEEDADLVAAsdessssssaaaaeeaeaAFMKVF 542
                           *****9988777779************8..555555.9*********************999444478999****************** PP

                  GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                           +e l+++sa +dsle+++p++s+er  +Er+  gr+iv++v+c  +e++er+et ++W +r+++aGF+pv++s+++a+++++llr++  
  Sobic.001G327900.2.p 543 TEGLRFFSAYMDSLEESFPKASNERLALERA-AGRAIVDLVSCPASESVERRETGASWARRMRSAGFSPVAFSDDVADDMRSLLRRYR- 629
                           *******************************.*******************************************************9. PP

                  GRAS 347 dgyrveee......sgslvlgWkdrpLvsvSaWr 374
                           +g+++ e        + ++l Wk++p+v++SaWr
  Sobic.001G327900.2.p 630 EGWTLREPgaddgvAAGVFLAWKEQPVVWTSAWR 663
                           99****8777777777888**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.897211638IPR005202Transcription factor GRAS
PfamPF035144.7E-24238344IPR005202Transcription factor GRAS
PfamPF035145.3E-64368663IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MDTLFRLVSL HQHHQHQQAA AGAASSSPDQ HHHQSPYSSR STTSRSSTTS TGSRSSPSSY  60
HTHNHHSNSH SHSHSYYSSS QAAGYYYDNP AGSGSGSGSG GGGGGGSGGG YYYDHHHHHH  120
QPAAAPYQEE CGNDHRFYMD EDFSSSSSSR HFQPRGAPPA QPPPSSSPAP TPPHQQPAST  180
SSGAAAGGGG HLFEAADFSF PQVDIDLDFS SPASSSGAGA AAASSSSGGG GAAGRWAAQL  240
LLECARAVAA RDSQRVQQLM WMLNELASPY GDVDQKLASY FLQGLFARLT TSGPRTLRTL  300
AAASDRNTSF ESTRRTALRF QELSPWASFG HVAANGAILE AFLEASAAGA AAASSSTSSS  360
SSQQQQPPRL HILDLSNTFC TQWPTLLEAL ATRSSDDTPH LSITTVVPTA APGSAAAQRV  420
MREIAQRLEK FARLMGVPFT FRAVHHAGDL AELDLDGLDL RREGEGGATT ALAINCVNAL  480
RGVAPGGARR RDAFVASLRR LEPRVVTVVE EDADLVAASD ESSSSSSAAA AEEAEAAFMK  540
VFTEGLRFFS AYMDSLEESF PKASNERLAL ERAAGRAIVD LVSCPASESV ERRETGASWA  600
RRMRSAGFSP VAFSDDVADD MRSLLRRYRE GWTLREPGAD DGVAAGVFLA WKEQPVVWTS  660
AWRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-15419066461474Protein SHORT-ROOT
5b3h_B1e-1551906647420Protein SHORT-ROOT
5b3h_E1e-1551906647420Protein SHORT-ROOT
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196106SGSGGGGGGGS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.134841e-100callus| embryo| shoot
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In P3 leaf primordium, expressed ubiquitously in the L1 layer and in the inner cells at lower levels. Not limited to the developing stomata until the last cell divisions. {ECO:0000269|PubMed:12974810}.
UniprotTISSUE SPECIFICITY: Expressed in leaves and roots. Detected in the stele, the endodermis and part of the cortex. {ECO:0000269|PubMed:12974810, ECO:0000269|PubMed:17446396}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for the asymmetric cell division involved in radial pattern formation in roots. Essential for both cell division and cell specification. {ECO:0000269|PubMed:17446396}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G327900.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270150.0KJ727015.1 Zea mays clone pUT3996 GRAS transcription factor (GRAS58) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467655.10.0protein SHORT-ROOT 2
SwissprotQ8H2X80.0SHR1_ORYSJ; Protein SHORT-ROOT 1
TrEMBLC5WVK00.0C5WVK0_SORBI; Uncharacterized protein
STRINGSb01g031720.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-125GRAS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]