PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G304500.1.p
Common NameSb01g029650, SORBIDRAFT_01g029650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 641aa    MW: 66792.2 Da    PI: 6.3412
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G304500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS284.33.5e-872846392374
                  GRAS   2 velLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                           v++L e+A+  ++gd+  a+++Larl+ +   +  +g+p+ R a+yf+eAL+  l+     + +a ++  +++++++ +l a+k+fsev
  Sobic.001G304500.1.p 284 VDQLAEAAKLAEAGDAFGAREILARLNYRlpaVPTAGTPLLRSAFYFKEALRVALSP----TGEAPAAPVSTPYDVVLKLGAYKAFSEV 368
                           689*************************999455566*******************9....66666666677789************** PP

                  GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                           sP+l+f+hlt+ qa+l+++ g++r+H++Dfdi++G QW++L+q+La+R  ++++l++T+++ ++s++  el+ ++e+L+ fA+elgv +
  Sobic.001G304500.1.p 369 SPVLQFAHLTCVQAVLDELGGASRIHVLDFDIGMGEQWASLMQELAQR-CPAATLKVTALVTSASHHPLELNLIHENLSGFARELGVFL 456
                           ***********************************************9.7889************************************ PP

                  GRAS 177 efnvlvakrledleleeL.rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           +f v+   ++++l++ eL ++ +g+a+aV+l +   ++         + ++vL+lvk+l +kvvv v++ +d+++ +F++++++a++ +
  Sobic.001G304500.1.p 457 QFAVF---NIDTLDPAELvAITSGDAVAVHLPVGSAHVA--------AMPAVLRLVKRLGAKVVVSVDHGCDRTELPFATHLFQAFQSC 534
                           ****9...999999999945566***********99998........4566************************************** PP

                  GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                           ++l+ds++a  ++++e+ + +Er+l++++++  v  ++++          Wr  + +aGF pv+ s++a++qa++ll++++  g+rve+
  Sobic.001G304500.1.p 535 VSLLDSVDAV-GADAEAVARIERFLVQPDVELRVVSRHRA----SAPPPAWRTVFASAGFVPVQASTFAESQAEALLKRMALMGFRVEK 618
                           *******987.8999****************999998888....88999**************************************** PP

                  GRAS 354 esgslvlgWkdrpLvsvSaWr 374
                           + g+l+l+W++ +LvsvSaWr
  Sobic.001G304500.1.p 619 RGGALCLYWQRGELVSVSAWR 639
                           ********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.876257619IPR005202Transcription factor GRAS
PfamPF035141.2E-84284639IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
MRGMLFAGSA REGHAGTLLQ QQQQRQGLAA GKVSGAGDLW EPTSVLDHRH SPSPSPPTSV  60
STLSSPLGAA TAGVAALAGA NAKNVSPPPV AAAWPGGGPG EEAVAGGKEE WQLTPLDMGL  120
SAGEGWDAAG AVLSDGAAPP GLAPDHTFLR WIIGGEDASA AMGSVMDPPV LELDHAPSMM  180
SPAFGASMPF APAMEDVKAV PFGHTPNFLV HHHQHHPQPH AAFFGSHSHA SLDAAPQPKR  240
PHPMAGAPAP KLPSFPGPVA QPGGFAPALK PKAEAANDEA TAAVDQLAEA AKLAEAGDAF  300
GAREILARLN YRLPAVPTAG TPLLRSAFYF KEALRVALSP TGEAPAAPVS TPYDVVLKLG  360
AYKAFSEVSP VLQFAHLTCV QAVLDELGGA SRIHVLDFDI GMGEQWASLM QELAQRCPAA  420
TLKVTALVTS ASHHPLELNL IHENLSGFAR ELGVFLQFAV FNIDTLDPAE LVAITSGDAV  480
AVHLPVGSAH VAAMPAVLRL VKRLGAKVVV SVDHGCDRTE LPFATHLFQA FQSCVSLLDS  540
VDAVGADAEA VARIERFLVQ PDVELRVVSR HRASAPPPAW RTVFASAGFV PVQASTFAES  600
QAEALLKRMA LMGFRVEKRG GALCLYWQRG ELVSVSAWRC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-2731563932375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G304500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277570.0KJ727757.1 Zea mays clone pUT5701 GRAS transcription factor (GRAS33) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464970.10.0scarecrow-like protein 6
TrEMBLC5WSJ80.0C5WSJ8_SORBI; Uncharacterized protein
STRINGSb01g029650.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67232954
Representative plantOGRP17501242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-84GRAS family protein