PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G278800.1.p
Common NameSb01g027430, SORBIDRAFT_01g027430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 255aa    MW: 27769.6 Da    PI: 8.2339
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G278800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-18100154256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++keq   Le++F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Sobic.001G278800.1.p 100 RKKLRLSKEQSALLEDHFKEHSTLNPKQKAALARQLNLRPRQVEVWFQNRRARTK 154
                           788899***********************************************98 PP

2HD-ZIP_I/II125.72.1e-40100188190
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rlskeq++lLE++F+e+++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL++e ++Lr 
  Sobic.001G278800.1.p 100 RKKLRLSKEQSALLEDHFKEHSTLNPKQKAALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCETLTEENRRLHRELQQLR- 187
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 e 90 
                           +
  Sobic.001G278800.1.p 188 A 188
                           3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.52E-1987157IPR009057Homeodomain-like
PROSITE profilePS5007117.13596156IPR001356Homeobox domain
SMARTSM003895.2E-1698160IPR001356Homeobox domain
CDDcd000864.26E-16100157No hitNo description
PfamPF000467.2E-16100154IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.0E-18100154IPR009057Homeodomain-like
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PfamPF021832.1E-10156189IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.4E-21156199IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MEQEEVGLAL GLSLGSGHHQ QLKEQPPPSS HPCALLEPTL SLSSLPAKDG LTTTPMRRIA  60
AVKRELQVEE DDEATDRALI YSVASSAVVT ADDDEGCNSR KKLRLSKEQS ALLEDHFKEH  120
STLNPKQKAA LARQLNLRPR QVEVWFQNRR ARTKLKQTEV DCELLKRCCE TLTEENRRLH  180
RELQQLRALS HPHPAAAFFM PAAAALSICP SCERIATGAS AAATTTGADR PNKAGGGPVR  240
APHLFSPFTK SAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198104SRKKLRL
2148156RRARTKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G278800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0545801e-178BT054580.1 Zea mays full-length cDNA clone ZM_BFc0164J19 mRNA, complete cds.
GenBankEU9620301e-178EU962030.1 Zea mays clone 239717 homeobox-leucine zipper protein HAT22 mRNA, complete cds.
GenBankKJ7276181e-178KJ727618.1 Zea mays clone pUT5529 HB transcription factor (HB121) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464840.10.0homeobox-leucine zipper protein HOX15
SwissprotQ7G7374e-83HOX15_ORYSJ; Homeobox-leucine zipper protein HOX15
TrEMBLC5WQI40.0C5WQI4_SORBI; Uncharacterized protein
STRINGSb01g027430.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.18e-61HD-ZIP family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]