PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G252800.1.p
Common NameSb01g022330, SORBIDRAFT_01g022330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 477aa    MW: 49778 Da    PI: 6.7751
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G252800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-39107166261
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                           ++k l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrknk++
  Sobic.001G252800.1.p 107 PDKVLPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKNKNA 166
                           78999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-31103164IPR003851Zinc finger, Dof-type
PfamPF027017.8E-32108165IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.984111165IPR003851Zinc finger, Dof-type
PROSITE patternPS013610113149IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MMAECQGGGG GDFLIKLFGK TIPVPESGDA KDLQQSSSSS SSTEQDHQDA HALDQENPHP  60
DSSDPSPQPE VVDAEDPKSS PETTHQKPGQ GNGSGDAASQ REKLKKPDKV LPCPRCNSMD  120
TKFCYFNNYN VNQPRHFCKN CQRYWTAGGA MRNVPVGAGR RKNKNAVAAS HFLHRVGAAC  180
GGGGDTLKTT NGTVLSFGGH GGGCVPPGPA CLDLVEQLSH HLAAPVIRNA GNNPGPCSEG  240
SSNCRDDNKT INDRSCVDEA AAANGDDGSV QHPASMNNGG ATVWPPPYSC APSPAAYFSS  300
GIAIPIYPAA PGYWGCMVPG AWSLPWPVQQ PPSSQSQGPA AGLSSSTSPT TTSAPSVSSS  360
GAADSHTLGL GKHPRDREEG DDGRNAKVWA PKTIRIDDVD EVARSSIWSL IGIKGDKAKQ  420
QDDDAAGGHK QKQLVGMVFE PKREATKKPA AMMTSSPLLH ANPVALTRSV AFQEGS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G252800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5823990.0KC582399.1 Sorghum bicolor dof2 protein (dof2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464638.10.0cyclic dof factor 1
TrEMBLC5WM750.0C5WM75_SORBI; Uncharacterized protein
STRINGSb01g022330.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-41cycling DOF factor 1