PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G229200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GATA
Protein Properties Length: 458aa    MW: 47988.8 Da    PI: 10.417
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G229200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83.1e-1899133135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C++Cgt++Tp+WR+gp g +tLCnaCG++yr  +l
  Sobic.001G229200.1.p  99 CRHCGTKSTPQWREGPMGRRTLCNACGIKYRAGRL 133
                           *******************************8875 PP

2GATA57.22.2e-18377411135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C++Cgt kTp WR+gpdg +tLCnaCG +y+k gl
  Sobic.001G229200.1.p 377 CQHCGTEKTPRWREGPDGRRTLCNACGQRYKKGGL 411
                           ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.14993129IPR000679Zinc finger, GATA-type
SMARTSM004019.0E-1793143IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.66E-1496156No hitNo description
Gene3DG3DSA:3.30.50.105.5E-1497130IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.48E-1498146No hitNo description
PfamPF003207.7E-1699133IPR000679Zinc finger, GATA-type
PROSITE patternPS00344099124IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.648371427IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-14371421IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.09E-13374433No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14375411IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440377402IPR000679Zinc finger, GATA-type
PfamPF003202.0E-16377411IPR000679Zinc finger, GATA-type
CDDcd002027.69E-16377432No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MVVVDALHGD SATAAADELF GSGTGYADLQ AFFDHTALKV KASGCGSDDE EELEWLSNKD  60
AFPTVETMDS AGARPRPRKK GVRQSRAVVA WSAAARRQCR HCGTKSTPQW REGPMGRRTL  120
CNACGIKYRA GRLLPEYRPA KSPTFSSELH SNRHDRIVEL RRLRGETVQT SLAAAGYGKE  180
GGQELERLSN KSVFLAVDTM APAGQRPRTK GLQRPRRVLA WSPPPPPRTP VQGRVPGGGG  240
ADGGRAAAPA GGGVEAIAPW ALAVAGPRRS QGGRDGMAIE QRRVPGGGDD GVGGDAATDE  300
GRAVGQRLNQ PGPGGGEMAL DQGLRVPFVG DNCTAGGGAA DKGRPAAAAA PSGGGVDHAA  360
RAAALQTPAS AVAQRWCQHC GTEKTPRWRE GPDGRRTLCN ACGQRYKKGG LVPEYRPASS  420
PTFSPTRHSN HRRILQQLRA SPVVTTATAA VFDAGDK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G229200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021315684.10.0uncharacterized protein LOC8070522 isoform X2
TrEMBLA0A1B6QKH50.0A0A1B6QKH5_SORBI; Uncharacterized protein
STRINGSb01g020090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.26e-30GATA transcription factor 5