PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G206300.1.p
Common NameSb01g018240, SORBIDRAFT_01g018240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 262aa    MW: 26378.4 Da    PI: 9.273
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G206300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof103.51.2e-3291145559
                zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                            ++cprC+s+ntkfCyynnys +qPry+CkaCrr+Wt+GG+lr+vPvGggr++++
  Sobic.001G206300.1.p  91 PRQCPRCQSANTKFCYYNNYSREQPRYLCKACRRHWTEGGTLRDVPVGGGRKNRR 145
                           679**********************************************987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.1E-3092144IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.91992146IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-1699136IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MPSSFLTSPS SSASSHLSYL IPASARPPPP LAMGQGYGGA TGGISVVPTG GVVATTNALN  60
AAAAAPPPPR QGSASRNAGG AGHPPLPRPP PRQCPRCQSA NTKFCYYNNY SREQPRYLCK  120
ACRRHWTEGG TLRDVPVGGG RKNRRGAKGG SAKASASAAA AATNVLGVGG ADTFPDFLRQ  180
QLLQFQPGAA VGGGGYAIDL GAWQQMSAAT APPPPPQGTG GDVSTLGAAG TTAAEAEANC  240
VALQYWSEWQ QDGMPGFDGA C*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.202875e-39callus
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G206300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279851e-158KJ727985.1 Zea mays clone pUT6101 C2C2-DOF transcription factor (DOF13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464429.10.0dof zinc finger protein DOF2.4
RefseqXP_021307462.10.0dof zinc finger protein DOF2.4
TrEMBLC5WXA90.0C5WXA9_SORBI; Uncharacterized protein
STRINGSb01g018240.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.14e-17Dof family protein