PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G179300.1.p
Common NameDof5, Sb01g015610, SORBIDRAFT_01g015610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 386aa    MW: 38461.7 Da    PI: 8.1318
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G179300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-3942102262
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           +e+ l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvPvGgg+rknk+s+
  Sobic.001G179300.1.p  42 PEQGLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKRSR 102
                           67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.3E-3344100IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-264699IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60946100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MASATTAATG DDAVGTRKGG TGGATAGGGT APQTQQQTPP PPEQGLRCPR CDSPNTKFCY  60
YNNYSLSQPR HFCKTCRRYW TKGGALRNVP VGGGCRKNKR SRSAAAVAVA AAAAASRLSL  120
NLPPAEAAAA DQQQAAARLG FLGAAHHHPA VASSPIGGAG APAADYHHQQ AGMMALQPRL  180
HGPGAVVGQY VPFGDWPSSG DVSSGGGCHA VNGGAAAAVS MSSSIASSIE SLSFINQDLH  240
WKLQQQRLAT MFLGTPTTSS GAAAGAHVDG AAAAAGAAAP HVVGGTFLHM AAGPPPPHGM  300
VEATTMAPPA ATSWFMDSSC YVLPSPTTAH HANTAAAAVV ATSNCNVVNS SGGGDDDNAT  360
SNNNNCGPGS AIPSWGDMST FAMLP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G179300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824020.0KC582402.1 Sorghum bicolor dof5 protein (dof5) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464283.10.0uncharacterized protein LOC8064546
TrEMBLC5WU640.0C5WU64_SORBI; Dof-type zinc finger protein 5
STRINGSb01g015610.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-31TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]