PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G174500.1.p
Common NameSb01g015180, SORBIDRAFT_01g015180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 687aa    MW: 78064 Da    PI: 6.673
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G174500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.51.1e-1063056761374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++ L++cA+avs ++++la+ +L+ +++++s +gd +qRla+y++  L+ rla+++s+ly++l ++  +       l++++l   v P
  Sobic.001G174500.1.p 305 LRTILIHCAQAVSVNNHTLANDMLNIIRHHSSITGDDTQRLAFYLVDCLEVRLAGTGSQLYRKLLTKICN---PMGILKVFQLTLAVNP 390
                           5789**********************************************************99999998...68889999999***** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvp 175
                           +++ s+  aN++Il+  +g+++vHiiDf+i  G+QWp+L+++La+R++gpp++RiTg++ p++g   ++ + ++tg+rLa++A+ ++vp
  Sobic.001G174500.1.p 391 LPRASFYFANKTILDVSKGKSKVHIIDFGIYFGFQWPSLFEQLAKREDGPPKVRITGIELPKQGfrpNQMNKQNTGQRLADYASMFNVP 479
                           **************************************************************99*9999999***************** PP

                  GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           fe+++ +++++e++ +e+L+++++++l+Vn++++++++ de+ s++s+r++vL++++ ++Pkv+v+   + +++++ Fl+rf e +++y
  Sobic.001G174500.1.p 480 FEYQA-ISSKWETICIEDLNIEEDDVLIVNCIYRMKSVGDETISINSARNRVLNTIRMMKPKVFVHGIVNGSYSTPFFLTRFKEVMYHY 567
                           *****.7********************************************************************************** PP

                  GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                           salfd +++++pr++e+r+ +Er +++ ++ nv+aceg+er+er e+++kW++r  +aG++++pl+ +++k ++ ++ k+++d y ++e
  Sobic.001G174500.1.p 568 SALFDIFDKTVPRDHETRMLIERGIFQCQLLNVIACEGSERIERPENYKKWKSRNLNAGLEQLPLNPDIVKVIREMVGKYHKD-YVINE 655
                           *********************************************************************************77.***** PP

                  GRAS 354 esgslvlgWkdrpLvsvSaWr 374
                           ++++l+lgWk+r L ++S W+
  Sobic.001G174500.1.p 656 DDHWLLLGWKGRILNAISTWK 676
                           ********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.894279657IPR005202Transcription factor GRAS
PfamPF035143.7E-104305676IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MHHYPTVSNT FSDSDHITLS TSYSSTIDGP QFSDLSSNAA PDWYGTSVAD SSNNSWTNSD  60
ITINYLNKLL MDEDDDDKVK LHHGECAVRA MEEPFYRILG QNNPAYPESP SLCSCGHLNN  120
LNDSVNKSSE LSCSSCCVAI DSSKNHSNHN LQAFEAPWSL TDIVEERRHS TEGTQNMELG  180
VKIDGLSIAE KRRRDNHSFQ VNAADTSKHA SSEVHSGYYP CTEDSYLSEA SSSKHVAYSF  240
NGPIRDEMFD RVLLFAEHKP TDEAIVLQQM MTNKSTEHSQ NEQGRTSAQW RTRGKKQQKK  300
EVVDLRTILI HCAQAVSVNN HTLANDMLNI IRHHSSITGD DTQRLAFYLV DCLEVRLAGT  360
GSQLYRKLLT KICNPMGILK VFQLTLAVNP LPRASFYFAN KTILDVSKGK SKVHIIDFGI  420
YFGFQWPSLF EQLAKREDGP PKVRITGIEL PKQGFRPNQM NKQNTGQRLA DYASMFNVPF  480
EYQAISSKWE TICIEDLNIE EDDVLIVNCI YRMKSVGDET ISINSARNRV LNTIRMMKPK  540
VFVHGIVNGS YSTPFFLTRF KEVMYHYSAL FDIFDKTVPR DHETRMLIER GIFQCQLLNV  600
IACEGSERIE RPENYKKWKS RNLNAGLEQL PLNPDIVKVI REMVGKYHKD YVINEDDHWL  660
LLGWKGRILN AISTWKPSES YDGDKT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A7e-442956778379Protein SCARECROW
5b3h_D7e-442956778379Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G174500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280170.0KJ728017.1 Zea mays clone pUT6153 GRAS transcription factor (GRAS16) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466850.10.0scarecrow-like protein 9
TrEMBLA0A1Z5S6400.0A0A1Z5S640_SORBI; Uncharacterized protein
STRINGSb01g015180.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Representative plantOGRP1136547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-144GRAS family protein