PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G174300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 749aa    MW: 84361.7 Da    PI: 5.8989
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G174300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS338.89.8e-1043707402374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           +  L++cA+avs ++++la+ +L+ +++++s +gd +qRla++++  L+ rla+++ +ly++l +++++    +  l++l+l   v P+
  Sobic.001G174300.1.p 370 RAILIHCAQAVSVNNHTLANDMLNIIRQHSSITGDDTQRLAFCLVDCLEVRLAGTGCQLYRKLITKSSN---AVAILKVLQLSLAVNPL 455
                           678*********************************************************999998887...9999************* PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpf 176
                           l+ s+   N++Il+  +g+++vHiiDf+i  G+QWp+L+++La+R++gpp++RiTg+++p +g   ++ + ++tg+rLa++A+ ++vpf
  Sobic.001G174300.1.p 456 LRASFYFSNKTILDVSKGKSKVHIIDFGICFGFQWPSLFEQLAKREDGPPKVRITGIEQPMQGfrpNQMNKQNTGQRLADYASMFNVPF 544
                           ************************************************************999999999999***************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           e+++ +++ +e++++e+L+++++++l+Vn++ +++ l de+vs++s+r++vL++++ ++Pk++v+   + +++++ Fl+rf e +++ys
  Sobic.001G174300.1.p 545 EYQA-ISSMWETISIEDLNIEEDDVLIVNCIDRMKILGDETVSINSARNKVLNTIRMMKPKIFVHGVVNGSYGTPIFLTRFKEVMYHYS 632
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           alfd +++++pr++e+r  +Er ++  ++ nv+aceg+er+er e+++kW++r  +aG++++pl+ ++++ ++ ++ k+++d y + e+
  Sobic.001G174300.1.p 633 ALFDIFDKTVPRDNETRLHIERSMFLSQLLNVIACEGSERIERPENYKKWKSRSLNAGLEQLPLNPDIVEVIREMVGKYHKD-YVIYED 720
                           ********************************************************************************77.****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                           +++l+lgWk+r L  +S W+
  Sobic.001G174300.1.p 721 DQWLLLGWKGRILNGISTWK 740
                           *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.205343721IPR005202Transcription factor GRAS
PfamPF035143.4E-101370740IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MGTCKALSDF WQGSRTPSME FNDKSSSNFE DFQSNMSATS GFYALVDPAD ESNDLESFLH  60
QPRSKHHYPP VSNTFSDSDH ITLSTPYSST VDGPQFCDLS SNAAPDWYGT SVADSSNNSW  120
TNSDITIDYL NKLLMDEDDE DKVKLHHGEC ALRAMEEPFY RILGQNNPAY PESPSLCSCG  180
HLNNLDDSIN KSSGLSCSSC SVAIDSSNSH SNHNLQAFEA PWSLSDIVKE TKRSTEGTRN  240
MEFGVKIDGL SIAEKRSRDN QSLQVNAADT SKHASSEVHS GYFSSTEDSY LSEARSSKQV  300
AFSFNEPTRD EMFDRVLLFS EHKPTDEAIV LQEMMTNKST GHSQNEQGRT SARRKTRGKK  360
QQKKEVVDLR AILIHCAQAV SVNNHTLAND MLNIIRQHSS ITGDDTQRLA FCLVDCLEVR  420
LAGTGCQLYR KLITKSSNAV AILKVLQLSL AVNPLLRASF YFSNKTILDV SKGKSKVHII  480
DFGICFGFQW PSLFEQLAKR EDGPPKVRIT GIEQPMQGFR PNQMNKQNTG QRLADYASMF  540
NVPFEYQAIS SMWETISIED LNIEEDDVLI VNCIDRMKIL GDETVSINSA RNKVLNTIRM  600
MKPKIFVHGV VNGSYGTPIF LTRFKEVMYH YSALFDIFDK TVPRDNETRL HIERSMFLSQ  660
LLNVIACEGS ERIERPENYK KWKSRSLNAG LEQLPLNPDI VEVIREMVGK YHKDYVIYED  720
DQWLLLGWKG RILNGISTWK PSESYVGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-433537413380Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G174300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280170.0KJ728017.1 Zea mays clone pUT6153 GRAS transcription factor (GRAS16) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021314676.10.0scarecrow-like protein 34
TrEMBLA0A1Z5S6H00.0A0A1Z5S6H0_SORBI; Uncharacterized protein
STRINGGRMZM2G335814_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Representative plantOGRP1136547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein