PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G174200.1.p
Common NameSb01g015170, SORBIDRAFT_01g015170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 721aa    MW: 81437.3 Da    PI: 7.1389
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G174200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS343.83e-1053467161374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lL++cA+avs ++ +la+ +L+ +++++s +gd +qRla++++e L+ rla+++ +ly++l +++ +    +++l++++l   vsP
  Sobic.001G174200.1.p 346 LRTLLIHCAKAVSVNKYTLARDTLNIIRQHSSVSGDDTQRLASCLVECLEVRLAGTGGQLYHKLMTETCN---AVDTLKVYQLALAVSP 431
                           6789**********************************************************99999998...9*************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           +++  +   N++Il+  +g+ +vHiiDf+i  G+QWp+L+++La R++gpp++RiTg++ p++g   ++  ++ g+ La++A+ ++vpf
  Sobic.001G174200.1.p 432 FMRAPYYFSNKTILDVSKGKPKVHIIDFGICFGFQWPSLFEQLARREDGPPKVRITGIELPQPGfrPNQINKNAGQLLADYASMFNVPF 520
                           ***************************************************************9998999999**************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           e++  +++++e++++++L+++++++l+Vn+ +++++++de+v+l+++r+++L+++++++Pkv+v+   + + +++ Fl rf e +++ys
  Sobic.001G174200.1.p 521 EYKG-ISSKWETIRIQDLNIEEDDVLIVNCLFRMKNIVDETVELNNARNRLLNTIRKMKPKVFVHGVVNGSFSNPFFLPRFKEVMHHYS 608
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           alfd l+ ++pr++e+r+ +Er++  r+i n+vaceg+er+er e ++kW++r  +aG++++pl+ +++k ++ ++ ++++d y ++e+
  Sobic.001G174200.1.p 609 ALFDILDRTVPRDNEARMILERHIYLRAILNAVACEGSERIERPECYKKWKSRNLKAGLEQLPLNPDIVKVIRDMVGQYHKD-YVINED 696
                           ********************************************************************************77.****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                           +++lvlgWk++ L ++S W+
  Sobic.001G174200.1.p 697 DQWLVLGWKGKILKAISTWK 716
                           *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.829320697IPR005202Transcription factor GRAS
PfamPF035141.0E-102346716IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
MESKDKPNSS FEDSPSAMVN NPGCYATSQI FIDDPTNRHN DLDLESCLHT PNSNYPPVSS  60
SSNSNVHVAS STSSSTKIYG PHPCEVSSNV KSDWYGANAT DYSANSWITS DITLDYINKL  120
LMQEDNDDTV KLHHGEHALR SMEEPFYKLL GQNNPVYPQQ LPLCNCDHLK NIDDSISKSC  180
SICSVAIDSS TSHSNHNLQV FEAPWSLSDI VTQGTHSVEL GLNVDGLSIA EKRSRDDQSL  240
QVHVADKIKH ALSEVHDGNY SRTEDFQLLE GRSSKQFAVS INGATRDEML DRVLLFSEHK  300
LTDEGIVLQE MMANKSTRNS KNVQGRTSAC RKTRIKKQHK KEVVDLRTLL IHCAKAVSVN  360
KYTLARDTLN IIRQHSSVSG DDTQRLASCL VECLEVRLAG TGGQLYHKLM TETCNAVDTL  420
KVYQLALAVS PFMRAPYYFS NKTILDVSKG KPKVHIIDFG ICFGFQWPSL FEQLARREDG  480
PPKVRITGIE LPQPGFRPNQ INKNAGQLLA DYASMFNVPF EYKGISSKWE TIRIQDLNIE  540
EDDVLIVNCL FRMKNIVDET VELNNARNRL LNTIRKMKPK VFVHGVVNGS FSNPFFLPRF  600
KEVMHHYSAL FDILDRTVPR DNEARMILER HIYLRAILNA VACEGSERIE RPECYKKWKS  660
RNLKAGLEQL PLNPDIVKVI RDMVGQYHKD YVINEDDQWL VLGWKGKILK AISTWKPSES  720
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-413317173380Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G174200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466849.20.0scarecrow-like protein 34
TrEMBLA0A1B6QJH30.0A0A1B6QJH3_SORBI; Uncharacterized protein
STRINGSb01g015170.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Representative plantOGRP1136547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein