PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G174100.1.p
Common NameSb01g015165, SORBIDRAFT_01g015165
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 722aa    MW: 81945.4 Da    PI: 6.7321
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G174100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS319.19.2e-983437131374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lL++cA+ vs +d +la+  L+ +++++s +gd +qRla+++++ L+ rla+++ +ly++l +++ +    +++l++++l   vsP
  Sobic.001G174100.1.p 343 LRKLLIRCAQEVSVNDYTLASDRLNIIRQHSSVTGDDTQRLASCLVNCLEVRLAGTGGQLYHKLMTETCN---AVNTLKVYQLALAVSP 428
                           689***********************************************************99999998...999************* PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           +l++ +   N++I +  +g+ +vHiiDf+i  G+QWp+L++++a  ++gpp++RiTg++ p++g   +++ ++ g+ La++A+ ++vpf
  Sobic.001G174100.1.p 429 FLRVPYYFSNKTIIDVSKGKPKVHIIDFGICFGFQWPSLFEQFAGMEDGPPKVRITGIDLPQPGfrPNQMNKNAGQLLADYASMFNVPF 517
                           ***************************************************************9*999999****************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           e++  +++++e++ +++L+++++++l+Vn+ +++++l de+v  + +rd+vL++++ ++Pkv+v+   + +++++ Fl+rf e +++ys
  Sobic.001G174100.1.p 518 EYKG-ISSKWETICIQDLNIEEDDVLIVNCLYRMKNLGDETVYFNCARDKVLNIIRMMKPKVFVHGVVNGSYSTPFFLTRFKEVMYHYS 605
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           alfd l+ ++pr++e+r+ +Er + + +i n+vaceg+er+er e++++W+ r  +aG++++pl+ +++k ++  + ++++d y v+ +
  Sobic.001G174100.1.p 606 ALFDILDRTVPRDNEARMILERDIYQCAILNAVACEGSERIERPESYKNWKLRNLKAGLEQLPLDPDIVKVIRDTMGQYHKD-YVVDVD 693
                           ********************************************************************************77.****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                           +++lvlgWk+r L ++S W+
  Sobic.001G174100.1.p 694 DQWLVLGWKGRILRAISTWK 713
                           *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.925317694IPR005202Transcription factor GRAS
PfamPF035143.2E-95343713IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MESKDKSNSS FEDSPSTVNN PGCYATSQKF IDNPTNEHND LELCLHTPNP TVSSNSNSNG  60
HVASSTSSSA KIGPHPYEVS SNVESDWYRT NVTDYSANSW IASDVTLNYI NNLLMQEDSD  120
DRVRLHHGEY ALRAMEEPFN KLLGQNNPAY PHRLCNCDHL KNINDSVSKS CSICSVAIDS  180
TTSHSNHNLQ AFETPWSLSD IVKERKKFTQ STHIMELGLN VDGLSIAEKR SRDDQSLQVS  240
VVDKSNHASS EIHSGSYSRT EDFHLLEERS SKQFAVSFNG TTRDEMLDRV LLFSGHKLTN  300
EGIIFREMMT NKSTRNSQND QGRTSARWKT RVMKQHKKEV VDLRKLLIRC AQEVSVNDYT  360
LASDRLNIIR QHSSVTGDDT QRLASCLVNC LEVRLAGTGG QLYHKLMTET CNAVNTLKVY  420
QLALAVSPFL RVPYYFSNKT IIDVSKGKPK VHIIDFGICF GFQWPSLFEQ FAGMEDGPPK  480
VRITGIDLPQ PGFRPNQMNK NAGQLLADYA SMFNVPFEYK GISSKWETIC IQDLNIEEDD  540
VLIVNCLYRM KNLGDETVYF NCARDKVLNI IRMMKPKVFV HGVVNGSYST PFFLTRFKEV  600
MYHYSALFDI LDRTVPRDNE ARMILERDIY QCAILNAVAC EGSERIERPE SYKNWKLRNL  660
KAGLEQLPLD PDIVKVIRDT MGQYHKDYVV DVDDQWLVLG WKGRILRAIS TWKPSESYDG  720
N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-3534971425380Protein SCARECROW
5b3h_A1e-3534971424379Protein SCARECROW
5b3h_D1e-3534971424379Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G174100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466849.20.0scarecrow-like protein 34
TrEMBLC5WT940.0C5WT94_SORBI; Uncharacterized protein
STRINGSb01g015165.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Representative plantOGRP1136547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-149GRAS family protein