PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G166200.1.p
Common NameDof9, Sb01g014530, SORBIDRAFT_01g014530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 352aa    MW: 35519.9 Da    PI: 8.7035
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G166200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.49.7e-36100155560
                zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                             +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+ +
  Sobic.001G166200.1.p 100 GEQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKRPR 155
                           579*************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.559101155IPR003851Zinc finger, Dof-type
PfamPF027014.3E-31101153IPR003851Zinc finger, Dof-type
PROSITE patternPS013610103139IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-22103148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MAGQVMEAQA ARLQPPTMLA PPFAPLPHST TCKHDVHHHH LTTTTTTATM AATSGTTTNN  60
VVTRTGGAAA ADMAAYLQQL QDAAEAAAKS SGGTGGAARG EQCPRCASHD TKFCYYNNYN  120
TSQPRHFCRA CRRYWTLGGS LRNVPIGGST RKRPRLAHHQ HQQHARRAPA AAAAAHVFGL  180
GLGLGGAAPP PMMMMPPLPC SSSSSSLQGQ GQGQGQGGGG LLGSLFALGA AGAPPLLEGR  240
GAGSSSSFDF DLGLGLPTAG PLHLGEAAAA VQMQGLGLRG GGGNGNAAGS SSSFLWPAGL  300
LADNDDSVDT WTKMPPGAGA GSMWPDFFSS PPAAAAPQTG GMMLHGGAHL M*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G166200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824060.0KC582406.1 Sorghum bicolor dof9 protein (dof9) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464222.10.0dof zinc finger protein DOF3.4
TrEMBLC5WSA30.0C5WSA3_SORBI; Dof-type zinc finger protein 9
STRINGSb01g014530.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-25DOF zinc finger protein 1
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]