PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G166000.2.p
Common NameSb01g014500, SORBIDRAFT_01g014500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family B3
Protein Properties Length: 344aa    MW: 38411.5 Da    PI: 7.9555
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G166000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B359.65.5e-19341141399
                           TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                    B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                           ++ +v+p++fa+++gg    s t++le+++g+ ++v++  + + ++ +l+ GW+ Fv+an+++e+Df++F+++++s f   v++f++
  Sobic.001G166000.2.p  34 KHSMVVPNRFAKQFGGR--LSGTIKLESPNGNLYDVEV--SEHLNKLMLGHGWEAFVDANHIEENDFLIFRHIEKSHF--EVMIFDT 114
                           456***********988..778****************..*******************************9998888..8888876 PP

2B346.66.3e-152653402099
                           HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                    B3  20 kkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                            k+a++h  + +++ + ++ + + + We +++++ + +r +l++GW  Fv++ngL++gD ++F+l+++++  + v+++++
  Sobic.001G166000.2.p 265 TKYAAAHL-P-ASE-QTMVLQCKRKIWEARMKVTSGHRR-FLGRGWTTFVRDNGLRVGDLCLFELKNERKLIMEVHIISR 340
                           45555552.2.333.355667799*******66666555.69***********************988999899999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.1E-2220117IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.35E-2321121IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.08422115IPR003340B3 DNA binding domain
CDDcd100173.40E-2124113No hitNo description
SMARTSM010194.9E-1225115IPR003340B3 DNA binding domain
PfamPF023627.0E-1733113IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-20239339IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-18240339IPR015300DNA-binding pseudobarrel domain
CDDcd100173.71E-16245339No hitNo description
PROSITE profilePS5086312.097246341IPR003340B3 DNA binding domain
SMARTSM010191.8E-6250341IPR003340B3 DNA binding domain
PfamPF023621.4E-12264340IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MKKPCDCCKR YLDHLEQKNQ SLSCFLGHMT ANFKHSMVVP NRFAKQFGGR LSGTIKLESP  60
NGNLYDVEVS EHLNKLMLGH GWEAFVDANH IEENDFLIFR HIEKSHFEVM IFDTDGCEKV  120
FSCAGLRNTP CVQERSVDSV GISSSSCHDT TESSGSERFA RSEKSGSSNH GKTENMATTS  180
SSSEESGEHV SWKSDMEETS DGSPNSKDSG GPAEPSYILP GMSGLSRSQK KIIEAKVRAI  240
KSEVPIYIAI MRKTNAAVSK LEFGTKYAAA HLPASEQTMV LQCKRKIWEA RMKVTSGHRR  300
FLGRGWTTFV RDNGLRVGDL CLFELKNERK LIMEVHIISR EQF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G166000.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021307518.10.0putative B3 domain-containing protein Os03g0619850 isoform X1
TrEMBLA0A1Z5S6I70.0A0A1Z5S6I7_SORBI; Uncharacterized protein
STRINGSb01g014500.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Representative plantOGRP5872421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.11e-21B3 family protein