PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G154500.1.p
Common NameSb01g013430, SORBIDRAFT_01g013430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NF-YA
Protein Properties Length: 346aa    MW: 36519.2 Da    PI: 9.8114
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G154500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.53.4e-31173229158
             CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           d+p+YVN+KQy++Il+RR +Rak+e+e++l +k+rkpylheSRh hA+rR RgsgGrF
  Sobic.001G154500.1.p 173 DAPIYVNPKQYEGILRRRRARAKAESENRL-AKGRKPYLHESRHLHAMRRVRGSGGRF 229
                           68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.2E-34171232IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.477172232IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.0E-27175229IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-22175197IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-22206229IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MMSFKGHEGF GGQVSAATGA GSQVAASHGA AAAGAGPLPW WAGPQLLFGE PAPLSPEETR  60
RDSQFQVVPG AQGTPPDPAP PKRGTPEVLK FSVFQGNLES GGKGEKNPKN STTIALQSPF  120
PEYNGRFEIG LGQSMMVPSN YSCADQCYGM LTTYGMKSMS GGRMLLPLNA PADAPIYVNP  180
KQYEGILRRR RARAKAESEN RLAKGRKPYL HESRHLHAMR RVRGSGGRFL NTKKEGGHGT  240
DVDANGGSKM AAAAPSRLTM PPSSEPPRPP GLSNISNPHF HSQSSVSSLS GSDVSNIYGG  300
LEQPPRAPPF FTVLPPIMDG DHGGVTHISS FKWAASDSCC ELLKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-17173241271NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
4g91_A2e-17173230260HAPB protein
4g92_A2e-17173230260HAPB protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.19870.0panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9578630.0EU957863.1 Zea mays clone 1627559 nuclear transcription factor Y subunit A-10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464168.10.0hypothetical protein SORBIDRAFT_01g013430
TrEMBLC5WR580.0C5WR58_SORBI; Putative uncharacterized protein Sb01g013430
STRINGSb01g013430.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Representative plantOGRP51361122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.33e-27nuclear factor Y, subunit A10