PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G147000.1.p
Common NameSb01g012810, SORBIDRAFT_01g012810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 208aa    MW: 21403.2 Da    PI: 8.1332
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G147000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.43e-44361351100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++Cv+apyfp  +p+kfanvhk+FGasnv+kll+++p ++r da+sslvyeA+ar+rdPvyG+vg i++lqqq+e+
  Sobic.001G147000.1.p  36 PCAACKLLRRRCAAGCVFAPYFPPGEPHKFANVHKVFGASNVSKLLQEIPVQHRGDAVSSLVYEANARVRDPVYGCVGAISSLQQQVET 124
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+a+lal+++e
  Sobic.001G147000.1.p 125 LQAQLALAQAE 135
                           *******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.73735136IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-4436133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MRDAVVVMAV PGAAAGAGGG KSGSGGGAGG AASAAPCAAC KLLRRRCAAG CVFAPYFPPG  60
EPHKFANVHK VFGASNVSKL LQEIPVQHRG DAVSSLVYEA NARVRDPVYG CVGAISSLQQ  120
QVETLQAQLA LAQAEMVRLR MSNDYILHRL KAASRANGGG GSSYTGSPSS MSSPKTAEPE  180
AHCNATPELL DMVVDQPSMD DAHFWSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-503513810113LOB family transfactor Ramosa2.1
5ly0_B1e-503513810113LOB family transfactor Ramosa2.1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11826GGKSGSGGG
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G147000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0699110.0BT069911.1 Zea mays full-length cDNA clone ZM_BFb0321D10 mRNA, complete cds.
GenBankKJ7276500.0KJ727650.1 Zea mays clone pUT5577 LOB transcription factor (LOB19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466719.11e-151LOB domain-containing protein 4 isoform X1
SwissprotQ8LBW33e-57LBD12_ARATH; LOB domain-containing protein 12
TrEMBLC5WQF31e-149C5WQF3_SORBI; Uncharacterized protein
STRINGSb01g012810.11e-150(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-37LOB domain-containing protein 4
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]