PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G127800.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NF-YA
Protein Properties Length: 268aa    MW: 28089.2 Da    PI: 9.9907
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G127800.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.31.1e-32170226158
             CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           +ep+YVNaKQy++Il+RRq+Rak+e ekk+  k+rkpylheSRh+hA+rR+Rg+gGrF
  Sobic.001G127800.3.p 170 EEPVYVNAKQYHGILRRRQSRAKAELEKKV-VKARKPYLHESRHQHAMRRARGNGGRF 226
                           69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-36168229IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.498169229IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.9E-28171226IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.7E-25172194IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860174194IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.7E-25203226IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MESRPGGTNL VEPRGQGAAA LPSGGPAVQP WWTSSGAVLG AVSPAVVAPG SGVGIGLSSS  60
PAGGSGGGGT AKGAASDESS EDSRRSGEPR DGSSGQEKNH ATSQIPALVP EYLAPYSQLE  120
LNQSIASAAY QYPDPYYSGM VAPYGSQAVA HFQLPGLTQS RMPLPLEVSE EPVYVNAKQY  180
HGILRRRQSR AKAELEKKVV KARKPYLHES RHQHAMRRAR GNGGRFLNTK KSDNGTPNGR  240
AEPKKGDGNS EHLHVPPDLL QLRQNGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-22170234266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.91091e-161leaf| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9620760.0EU962076.1 Zea mays clone 240068 nuclear transcription factor Y subunit A-1 mRNA, complete cds.
GenBankBT0638030.0BT063803.1 Zea mays full-length cDNA clone ZM_BFc0109B09 mRNA, complete cds.
GenBankKJ7282930.0KJ728293.1 Zea mays clone pUT6573 CCAAT-HAP2 transcription factor (CA2P16) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982098.11e-157PREDICTED: nuclear transcription factor Y subunit A-1-like
TrEMBLK4ADT81e-157K4ADT8_SETIT; Uncharacterized protein
STRINGSb01g011220.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.21e-33nuclear factor Y, subunit A7