PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G120900.1.p
Common NameSb01g010660, SORBIDRAFT_01g010660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 628aa    MW: 66272.3 Da    PI: 4.8982
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G120900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.81.7e-1402456231374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           lv++Ll+cAeav+++++++a+al++++  las++g +m+++aayf eALa+r++r     ++  p ++  +  +++ l+a   f+e +P
  Sobic.001G120900.1.p 245 LVHALLACAEAVQQENFSAADALVKQIPMLASSQGGAMRKVAAYFGEALARRVYR-----FRPTPDTSLLDAAVADFLHA--HFYESCP 326
                           689****************************************************.....43333333333445555555..4****** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                           +lkf+h+taNqaIlea++g++rvH++Df+i+qGlQWpaLlqaLa Rp+gpps+R+Tgvg+p+++++++l+++g++La+fA++++v+f++
  Sobic.001G120900.1.p 327 YLKFAHFTANQAILEAFAGCRRVHVVDFGIKQGLQWPALLQALALRPGGPPSFRLTGVGPPQHDETDALQQVGWKLAQFAHTIRVDFQY 415
                           ***************************************************************************************** PP

                  GRAS 179 nvlvakrledleleeLrvkp......gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                           + lva +l+dle+ +L+ +        E++aVn+v++lhrll+++++le+    vL +v+ ++P++v+vveqea+hns++Fl+rf+e+l
  Sobic.001G120900.1.p 416 RGLVAATLADLEPFMLQPEGddkdeePEVIAVNSVFELHRLLAQPGALEK----VLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESL 500
                           ****************65544555679***********************....*********************************** PP

                  GRAS 262 eyysalfdsleak........lpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                           +yys++fdsle           p+++  +++++++++lgr+i+nvvacegaer+erhetl++Wr rl  +GF+pv+l+++a+kqa++ll
  Sobic.001G120900.1.p 501 HYYSTMFDSLEGAgsgqstdaSPAAAgGTDQVMSEVYLGRQICNVVACEGAERTERHETLSQWRGRLVGSGFEPVHLGSNAYKQASTLL 589
                           **********7775777766544444799************************************************************ PP

                  GRAS 342 rkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           + ++ +dgyrvee++g+l+lgW++rpL+++SaWr
  Sobic.001G120900.1.p 590 ALFNgGDGYRVEEKDGCLTLGWHTRPLIATSAWR 623
                           *********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120416.3E-3537113IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011293.1E-3137119No hitNo description
PROSITE profilePS5098567.736219602IPR005202Transcription factor GRAS
PfamPF035145.8E-138245623IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MKREYQDAGG SGGDMGSSKD KMMVAAAGAG EQEEELDEML ASLGYKVRSS DMADVAQKLE  60
QLEMAMGMGG VGGAGATADD GFISHLATDT VHYNPSDLSS WLESMLSELN APPPPLPPAT  120
TPPAPRLAST SSTVTSGAAA GAGYFDLPPA VDSSSSTYAL KPIPSPVAVA SADPSSTDST  180
REPKRMRTGG GSTSSSSSSS SSMDGGRTRS SVVEAAPPAT QAPAAANGPA VPVVVMDTQE  240
AGIRLVHALL ACAEAVQQEN FSAADALVKQ IPMLASSQGG AMRKVAAYFG EALARRVYRF  300
RPTPDTSLLD AAVADFLHAH FYESCPYLKF AHFTANQAIL EAFAGCRRVH VVDFGIKQGL  360
QWPALLQALA LRPGGPPSFR LTGVGPPQHD ETDALQQVGW KLAQFAHTIR VDFQYRGLVA  420
ATLADLEPFM LQPEGDDKDE EPEVIAVNSV FELHRLLAQP GALEKVLGTV RAVRPRIVTV  480
VEQEANHNSG TFLDRFTESL HYYSTMFDSL EGAGSGQSTD ASPAAAGGTD QVMSEVYLGR  540
QICNVVACEG AERTERHETL SQWRGRLVGS GFEPVHLGSN AYKQASTLLA LFNGGDGYRV  600
EEKDGCLTLG WHTRPLIATS AWRLAAP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-572456234375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.99660.0callus| embryo| panicle| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542620.0BT054262.1 Zea mays full-length cDNA clone ZM_BFb0203D23 mRNA, complete cds.
GenBankAJ2425300.0AJ242530.1 Zea mays partial d8 gene for gibberellin response modulator.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466594.10.0hypothetical protein SORBIDRAFT_01g010660
SwissprotQ9ST480.0DWRF8_MAIZE; DELLA protein DWARF8
TrEMBLC5WNR20.0C5WNR2_SORBI; Putative uncharacterized protein Sb01g010660
STRINGSb01g010660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-171GRAS family protein