PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G119700.1.p
Common NameSb01g010570, SORBIDRAFT_01g010570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GeBP
Protein Properties Length: 377aa    MW: 40277 Da    PI: 7.1032
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G119700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57384.31.7e-2686180297
                DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkife 90 
                           +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++ ql+eK+rrLK+Kf+ ++++++ g +p+  ++hd+++++
  Sobic.001G119700.1.p  86 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRAQLSEKLRRLKNKFRSMSARVAGGLDPARLAPHDRDVLH 173
                           79*******************.556878888********************************************************** PP

                DUF573  91 lskkiWg 97 
                           l++++W+
  Sobic.001G119700.1.p 174 LCSRLWD 180
                           ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.7E-2487180IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MASDQQALPV PVPVPVPPNP NPTAPADPTP PSASAARKLP IKRRSPRPSS SPPSSSSPTS  60
SDPLRAPAPG GGGGGGGSDQ QQPPFKFQRI WSESDELRFL QGLLGCGAQG LVFPRDLNVF  120
YDRFSESMPQ PYTRAQLSEK LRRLKNKFRS MSARVAGGLD PARLAPHDRD VLHLCSRLWD  180
PANAATSPFA ASAGASGNKR RRANPRGTPL LPPDASGDSN SHDYNGVGSS APGLFPDGSN  240
GEYMFYLEQE SGHLGDHEGA ALVADSRFGV VVQEQQPEAV VTLPNGNNGV GNEMNVECKM  300
VVPCSNEHRM ANAVLDVFEE CLREAKSNGI INGGNVDGRA EETELAKRWR AQRMDELDVL  360
SRRLRLLVEY AAATGQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G119700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9677790.0EU967779.1 Zea mays clone 306034 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464013.10.0probable transcription factor At3g04930
RefseqXP_021307245.10.0probable transcription factor At3g04930
TrEMBLC5WNQ30.0C5WNQ3_SORBI; Uncharacterized protein
STRINGSb01g010570.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Representative plantOGRP9800912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.25e-11DNA-binding storekeeper protein-related transcriptional regulator