PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G109100.1.p
Common NameSb01g009740, SORBIDRAFT_01g009740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 560aa    MW: 60350.7 Da    PI: 4.6719
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G109100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS350.82.2e-1071905593374
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           + Ll+c +  +  d  la a L +++  as dgdp +R+a+yf+ ALa+rla  + +   ++++ +     s+e +  +k++++++P+ 
  Sobic.001G109100.1.p 190 QSLLACSRTAA-ADPGLAAAELVQVRAAASDDGDPAERVAFYFADALARRLAC-GGGAQPTMAVDAR--FASDELTLCYKTLNDACPYS 274
                           77999998655.5889999999******************************8.4444444433333..35899999************ PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                           kf+hltaNqaIlea+ +++++Hi+Df+i qG+QW+aLlqaLa+Rp+++p ++Ri gv sp  g   +++l +t  rL++fA+ lgv+fe
  Sobic.001G109100.1.p 275 KFAHLTANQAILEATGTATKIHIVDFGIVQGIQWAALLQALATRPGEKPsRVRISGVPSPYLGpkPATSLAATSARLRDFAKLLGVDFE 363
                           *********************************************665559********99889899********************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           f + + + +++l+ ++++v+p+E++aVn++lql++ll   ++++++ ++vL+lvksl P vv++ e e+++n++ F++rf++al yy  
  Sobic.001G109100.1.p 364 FVP-LLRPVHELDRSDFSVEPDETVAVNFMLQLYHLL---GDSDEPVRRVLQLVKSLDPSVVTLGEYEVSLNRAGFVDRFANALLYYKP 448
                           ***.599******************************...66666777***************************************** PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvac.egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrvee 353
                           +f+sl++ +pr+s er+ vEr ++g++i+ ++   eg+er+ r+   ++W+  +e +GF+pv+ls++a++qa+lll +++ +  y++ e
  Sobic.001G109100.1.p 449 VFESLDVAMPRDSPERVRVERCMFGERIRRAIGPeEGEERTDRMAASREWQTLMEWCGFEPVKLSNYAMSQADLLLWNYDsKYKYSLVE 537
                           ********************************8615778*****************************************777899999 PP

                  GRAS 354 esgslv.lgWkdrpLvsvSaWr 374
                              +++ l W++rpL++vSaWr
  Sobic.001G109100.1.p 538 LPPAFLsLAWEKRPLLTVSAWR 559
                           9999988**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819953.66E-71464No hitNo description
SuperFamilySSF819953.66E-7105156No hitNo description
PROSITE profilePS5098556.392162537IPR005202Transcription factor GRAS
PfamPF035147.6E-105190559IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QQQQQQQHQR HHLPPPPMPL PLPPRQAPPM PPSPAPPHGQ  60
IPAASLPYGG GAWPQADHFF PDAFVGTSAA DAVFSDLAGA ADFDSDVWMD SLIGDAPVFA  120
DSDLERLIFT TPPPPVPAPV ATPAVAPVDA AAQPEAATPA SLPQPAAVAT PAACSSPSSL  180
DASCSAPILQ SLLACSRTAA ADPGLAAAEL VQVRAAASDD GDPAERVAFY FADALARRLA  240
CGGGAQPTMA VDARFASDEL TLCYKTLNDA CPYSKFAHLT ANQAILEATG TATKIHIVDF  300
GIVQGIQWAA LLQALATRPG EKPSRVRISG VPSPYLGPKP ATSLAATSAR LRDFAKLLGV  360
DFEFVPLLRP VHELDRSDFS VEPDETVAVN FMLQLYHLLG DSDEPVRRVL QLVKSLDPSV  420
VTLGEYEVSL NRAGFVDRFA NALLYYKPVF ESLDVAMPRD SPERVRVERC MFGERIRRAI  480
GPEEGEERTD RMAASREWQT LMEWCGFEPV KLSNYAMSQA DLLLWNYDSK YKYSLVELPP  540
AFLSLAWEKR PLLTVSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.01855591375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development (By similarity). Involved in environmental abiotic stress resistance. May increase the expression of stress-responsive genes (By similarity). Binds DNA in vitro (PubMed:27081181). {ECO:0000250|UniProtKB:A0A024B7I0, ECO:0000250|UniProtKB:Q9SCR0, ECO:0000269|PubMed:27081181}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G109100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270180.0KJ727018.1 Zea mays clone pUT3999 GRAS transcription factor (GRAS55) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021310559.10.0scarecrow-like protein 4
SwissprotQ53K160.0SCL7_ORYSJ; SCARECROW-LIKE protein 7
TrEMBLA0A1B6QID40.0A0A1B6QID4_SORBI; Uncharacterized protein
STRINGSb01g009740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Representative plantOGRP67991519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-133GRAS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Li S, et al.
    Crystal Structure of the GRAS Domain of SCARECROW-LIKE7 in Oryza sativa.
    Plant Cell, 2016. 28(5): p. 1025-34
    [PMID:27081181]