PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G078700.1.p
Common NameDof10, Sb01g007110, SORBIDRAFT_01g007110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 381aa    MW: 38671.8 Da    PI: 9.1322
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G078700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.7e-3879136360
                zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                           ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  Sobic.001G078700.1.p  79 QTPLRCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 136
                           66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-3181135IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2782133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09682136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MIQELLGGAA MDQLKSVNDV NAASLPLLLH PVISNPSPTS SSSTSSRSSA QQQQRSTSAT  60
SSPQGQGPQQ QGQGQGAEQT PLRCPRCNSS NTKFCYYNNY NLTQPRHFCK TCRRYWTKGG  120
ALRNVPIGGG CRKPRPMPTP VAKPVISSCK AVGGGVPSLG LGVGLGMGMG AGPGPWASSQ  180
QAAAAQLMAL LNSARGVHQG GGNMHRLLGL DAMAHLPLHV LPGAGNNNAG GTAPSLWPQS  240
APRAIPTPPH MDSQLGMGPL GQHDVLSSLG LKLPPPSSSP AAASYYSDQL HAVVSSAAGR  300
GGHEYEAAAS GAMSLPCTTA LTSLPPAASS VSAALTSCAT VGLDLPPVSV PASEMQYWAA  360
GPAAMSVAWP DLPTPNGAFP *
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G078700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824070.0KC582407.1 Sorghum bicolor dof10 protein (dof10) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463834.20.0uncharacterized protein LOC8086191
TrEMBLA0A1B6QHT90.0A0A1B6QHT9_SORBI; Uncharacterized protein
STRINGSb01g007110.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.11e-31Dof family protein
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]