PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G062700.1.p
Common NameSb01g005690, SORBIDRAFT_01g005690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GATA
Protein Properties Length: 368aa    MW: 38069.1 Da    PI: 7.4627
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G062700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.91.4e-18264299136
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkglk 36 
                           C++C + kTp+WR+gp g+ktLCnaCG+++++ +l+
  Sobic.001G062700.1.p 264 CTHCASEKTPQWRSGPLGPKTLCNACGVRFKSGRLM 299
                           ********************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.3E-17258308IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-13262296IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577167.6E-14262321No hitNo description
PROSITE profilePS5011411.227262294IPR000679Zinc finger, GATA-type
CDDcd002023.07E-14263310No hitNo description
PROSITE patternPS003440264289IPR000679Zinc finger, GATA-type
PfamPF003203.0E-16264299IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MASEWEMAMG VELGMGMGTY HHNASSITTA PMMSSHHNGG ASYSTVHHHH HYYGMPPMGD  60
DAAMRVDDLS TGGGAGAHEF FPTAATSGPM VGEPSPTVNS SDHQTSSLLS FADEFYIPSE  120
EAAELEWLSK FVDDSYSDMP NYSSAAHHAA MAAAAAANAA AAGNGGGTSA GQDSCVTAAA  180
PGRGARSKRS GRATAAAWQS LVPRPPSQSS SPIPSSPSCS SSDFTSSSNK PARPTNGGGS  240
RGKKSPAGTA GEEVGMVDGG VRRCTHCASE KTPQWRSGPL GPKTLCNACG VRFKSGRLMP  300
EYRPAASPTF VLTQHSNSHR KVVELRRQKE LILIRGSHRD AAAAAAAGSA GGPRPEELMF  360
RDYSGVC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.77880.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G062700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0688040.0BT068804.1 Zea mays full-length cDNA clone ZM_BFb0383N16 mRNA, complete cds.
GenBankBT0877980.0BT087798.1 Zea mays full-length cDNA clone ZM_BFb0206G21 mRNA, complete cds.
GenBankEU9562060.0EU956206.1 Zea mays clone 1559028 GATA transcription factor 9 mRNA, complete cds.
GenBankKJ7269570.0KJ726957.1 Zea mays clone pUT3655 C2C2-GATA transcription factor (GATA28) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463763.10.0GATA transcription factor 2
TrEMBLC5WY430.0C5WY43_SORBI; Uncharacterized protein
STRINGSb01g005690.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.14e-45GATA transcription factor 2