PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G034300.1.p
Common NameSb01g003210, SORBIDRAFT_01g003210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 436aa    MW: 43307.6 Da    PI: 9.4652
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G034300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-38121181262
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           +e  lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  Sobic.001G034300.1.p 121 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 181
                           56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-38105179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.609125179IPR003851Zinc finger, Dof-type
PfamPF027013.1E-32125179IPR003851Zinc finger, Dof-type
PROSITE patternPS013610127163IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWNQHQH QHQPQQQQQQ AHHGQLPSGG AGGGGGGGME AHAHHHHHHQ  60
LPPVPPPGGA LMAPRPDMAA VVAASGGGST PGAGGGPTAG GSAIRPGSMT ERARLAKIPQ  120
PEPGLKCPRC ESTNTKFCYF NNYSLSQPRH FCKTCRRYWT RGGALRNVPV GGGCRRNKRT  180
KSSKSNSSSA ASASGAGGTS SSTSSTATGG SSAGGASGAG IMPSHQGHGH LPFLASLHHP  240
LAGGDHYSTG ASRLGFPGLS SLDPVDYHQF GASAGAGGAA LGLEQWRLPQ IQHQFPFLSG  300
RPDAVPPTMS GIYPFDVEGH GGDGTGFAGH MLGASKVPGS AGLITQLASV KMEDNPASAA  360
MANSSPREFL GLPGNLQFWG GGSNGGANGN NGGGAGNAGG GGSGGGGGGG GGTVAPGSSW  420
VDLSGFNSSS SGNVL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1402412SGGGGGGGGGT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G034300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824010.0KC582401.1 Sorghum bicolor dof4 protein (dof4) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466192.10.0dof zinc finger protein DOF2.4
RefseqXP_021311357.10.0dof zinc finger protein DOF2.4
RefseqXP_021311390.10.0dof zinc finger protein DOF2.4
TrEMBLC5WV120.0C5WV12_SORBI; Uncharacterized protein
STRINGSb01g003210.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.15e-43Dof family protein