PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G033200.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 652aa    MW: 73395 Da    PI: 7.3416
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G033200.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS374.31.5e-1142806492373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL++cA+a + +d+++ ++ L+++++++s +gd+ qRla+yf+ +L+arla+++s++y++l++++ts   + + l+a++l+++++P+
  Sobic.001G033200.3.p 280 TTLLIHCAQAAAIDDHRNSSEHLKQIRKHSSATGDAGQRLAHYFADGLEARLAGTGSSIYRSLAAKRTS---TGDMLKAFNLYVKACPF 365
                           689************************************************************999999...899************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                             +sh +aN +Il+a+++ +r+HiiD++i++G+QWp L+q L++R++gpp+lRiTg++ p sg   +e++e+tg+rL+++A+ ++vpfe
  Sobic.001G033200.3.p 366 RIISHYVANTTILNATKSVTRLHIIDYGIMYGFQWPILMQRLSKRSGGPPTLRITGIDFPLSGfrPAERVEATGRRLHEYARMFNVPFE 454
                           ************************************************************99999************************ PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           +++ +a +++++++++L++k++E ++Vn+ +++ +++de+++ +s+r++vL+++++l+P+++v+   +  +n++ F++rf ea+ ++s+
  Sobic.001G033200.3.p 455 YQA-IAAKWDTIQVKDLNIKSDEFIVVNCLYRMRNMMDETATDDSPRTRVLNTIRKLNPHLFVHGIVNGTYNAPFFVTRFKEAMFFFSS 542
                           ***.799********************************************************************************** PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                           +fd+lea+++r +e+r  +Ere++gre+ nv+aceg+er+er et+++W++r  +aGF+++pl+ ++++ a++ ++k++ + + v+e++
  Sobic.001G033200.3.p 543 IFDMLEANASRMDEHRLLIEREFFGREAINVIACEGTERIERPETYKQWQMRNLRAGFRQLPLDREIMARARYKVSKTYPRDFLVDEDN 631
                           *******************************************************************************888******* PP

                  GRAS 356 gslvlgWkdrpLvsvSaW 373
                           +++++gWk+r ++++SaW
  Sobic.001G033200.3.p 632 KWMLQGWKGRVIYALSAW 649
                           ****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.735253630IPR005202Transcription factor GRAS
PfamPF035145.2E-112280649IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MIMDPRPRDN LNFGARLPTP NPPTPHMISF SLQQPQPQFF PSYGFHSHNH NNPAISSHPS  60
PPSVMPGCTT PSPASTTTTE ADNAEDLSEA VADDAVLAYI NQFLLEDEDE ESYPVTSVPV  120
EDSVLLAAVE KPFVDILKSA NHITAKAYEV KSWITDDCHS TGSGRFHDVV TSTLDSTQLA  180
PEMVQGDVVD AVHKGQKNPR DNDLEVERRK SKQSALCDEE TVREMFDKVL LCTDKNCAFH  240
SPMPADAQNS GGYVKGSGNR RGRRKGRSGA GAEQEPVDLT TLLIHCAQAA AIDDHRNSSE  300
HLKQIRKHSS ATGDAGQRLA HYFADGLEAR LAGTGSSIYR SLAAKRTSTG DMLKAFNLYV  360
KACPFRIISH YVANTTILNA TKSVTRLHII DYGIMYGFQW PILMQRLSKR SGGPPTLRIT  420
GIDFPLSGFR PAERVEATGR RLHEYARMFN VPFEYQAIAA KWDTIQVKDL NIKSDEFIVV  480
NCLYRMRNMM DETATDDSPR TRVLNTIRKL NPHLFVHGIV NGTYNAPFFV TRFKEAMFFF  540
SSIFDMLEAN ASRMDEHRLL IEREFFGREA INVIACEGTE RIERPETYKQ WQMRNLRAGF  600
RQLPLDREIM ARARYKVSKT YPRDFLVDED NKWMLQGWKG RVIYALSAWS T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-522836498374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.64220.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G033200.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1849080.0KF184908.1 Saccharum hybrid cultivar R570 clone BAC 006C11 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466184.20.0scarecrow-like protein 30
RefseqXP_021306618.10.0scarecrow-like protein 30
SwissprotQ9XE581e-169SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A1B6QH730.0A0A1B6QH73_SORBI; Uncharacterized protein
STRINGSb01g003110.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP138412529
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-169SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]