PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_74785.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TCP
Protein Properties Length: 102aa    MW: 11203.7 Da    PI: 7.2581
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_74785.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP82.11.5e-25165973
                      TCP  9 skihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                             sk++T +g+RdRR+Rlsa++a++++dLqd+LG+ ++sk i+WLlq+a+  +  l+ +++++  + 
  Rsa1.0_74785.1_g00001.1  1 SKVCTVRGLRDRRIRLSATTAIQLYDLQDRLGLSQPSKVIDWLLQAAQNDVAMLPPLQFPPGFHL 65
                             8*******************************************************988877444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.3E-23158IPR005333Transcription factor, TCP
PROSITE profilePS5136924.446154IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
SKVCTVRGLR DRRIRLSATT AIQLYDLQDR LGLSQPSKVI DWLLQAAQND VAMLPPLQFP  60
PGFHLNLPTA AAAVGESFPG IFESFDIGSC SSRTDQTTQR ET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A3e-18155155Putative transcription factor PCF6
5zkt_B3e-18155155Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_74785.1_g00001.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410041e-110AC241004.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026J02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018475137.17e-65PREDICTED: transcription factor TCP17
RefseqXP_018475138.17e-65PREDICTED: transcription factor TCP17
SwissprotQ9LEZ99e-40TCP17_ARATH; Transcription factor TCP17
TrEMBLA0A3P6A0R24e-59A0A3P6A0R2_BRACM; Uncharacterized protein
STRINGBo3g004670.18e-57(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35762763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08070.14e-42TCP domain protein 17
Publications ? help Back to Top
  1. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]