PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_23673.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family M-type_MADS
Protein Properties Length: 124aa    MW: 13946.3 Da    PI: 10.5864
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_23673.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF436e-141050242
                             ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                   SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                             +i n+s r++ + kR++g+lKKA E+ +LC+ ++  ii+s+
  Rsa1.0_23673.1_g00001.1 10 FIVNNSLRKTAYKKRKKGLLKKAPEIFTLCGNNAGAIIYSP 50
                             799************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-14160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.1E-17169IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.241149IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-6323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-111151IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MTRRKVKHAF IVNNSLRKTA YKKRKKGLLK KAPEIFTLCG NNAGAIIYSP YDPTPEVWPS  60
VEGMNQAMEM SRSVDQNTFI RIKPKPVQDT MQVKAKVSPT LDDKVHESST TCILHLSLSK  120
SVIS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RRKVKHAFIVNNSLRKTAYKKRK
21524LRKTAYKKRK
32125KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of gametophytes and seeds. {ECO:0000269|PubMed:12815071}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_23673.1_g00001.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA, FIS2 and FIE in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6084922e-73AB608492.1 Raphanus sativus DNA, microsatellite locus RsSH024, cultivar: rat-tail radish.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018458729.19e-33PREDICTED: agamous-like MADS-box protein AGL80
SwissprotO808058e-19PHE1_ARATH; MADS-box transcription factor PHERES 1
TrEMBLU5GF693e-22U5GF69_POPTR; Uncharacterized protein
STRINGPOPTR_0005s00420.12e-24(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-15AGAMOUS-like 80
Publications ? help Back to Top
  1. Raissig MT,Bemer M,Baroux C,Grossniklaus U
    Genomic imprinting in the Arabidopsis embryo is partly regulated by PRC2.
    PLoS Genet., 2013. 9(12): p. e1003862
    [PMID:24339783]
  2. Jeong CW, et al.
    Control of Paternally Expressed Imprinted UPWARD CURLY LEAF1, a Gene Encoding an F-Box Protein That Regulates CURLY LEAF Polycomb Protein, in the Arabidopsis Endosperm.
    PLoS ONE, 2015. 10(2): p. e0117431
    [PMID:25689861]
  3. Burkart-Waco D,Ngo K,Lieberman M,Comai L
    Perturbation of parentally biased gene expression during interspecific hybridization.
    PLoS ONE, 2015. 10(2): p. e0117293
    [PMID:25719202]
  4. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]