PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_21056.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 225aa    MW: 24880.7 Da    PI: 8.7363
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_21056.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.32e-30155212260
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                              +Dgy WrKYGqK+vk+se+prsY++Ct+++C +kk ve+++ d++++ei+Y+g Hnh+k
  Rsa1.0_21056.1_g00001.1 155 NDGYGWRKYGQKQVKKSENPRSYFKCTYPNCVSKKIVETAS-DGQITEIIYKGGHNHPK 212
                              8***************************************9.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-25145213IPR003657WRKY domain
SuperFamilySSF1182902.09E-23151213IPR003657WRKY domain
SMARTSM007741.3E-30154212IPR003657WRKY domain
PfamPF031066.8E-23155211IPR003657WRKY domain
PROSITE profilePS5081120.461155213IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MSSTSFTDLL ASSGVNSYEQ DEDFLGGFYP ERTGSGLPKF KTAQPPPLPI SQPSHGFAFS  60
EILDSPLLLS SSHSLISPTT GAFPYQCFNG TNNHSEFPWQ LQTQTQPPIA SSALQKTYVV  120
QDLQKKQEDP VPREFAADRQ VKAPSYTVVV SRNSNDGYGW RKYGQKQVKK SENPRSYFKC  180
TYPNCVSKKI VETASDGQIT EIIYKGGHNH PKPEFTKRPS GSSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-131552131574WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY33 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Plays a partial role in heat stress tolerance (PubMed:19125253). Functions with WRKY26 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253, ECO:0000269|PubMed:21336597}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_21056.1_g00001.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt stress (PubMed:18839316). Induced by heat stress (PubMed:19125253). {ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300430.0KF430043.1 Brassica rapa WRKY transcription factor 25 (WRKY25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018465503.11e-138PREDICTED: probable WRKY transcription factor 25
SwissprotO229211e-108WRK25_ARATH; Probable WRKY transcription factor 25
TrEMBLA0A3N6TRK21e-130A0A3N6TRK2_BRACR; Uncharacterized protein
STRINGBra018325.1-P1e-128(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116031733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30250.11e-107WRKY DNA-binding protein 25
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]