PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_15221.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 243aa    MW: 25972.1 Da    PI: 8.4607
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_15221.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.67.9e-31105163160
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                              ++DgynWrKYGqK vkg+ef rsYYrCt+++C++kk++ers   +++v+++Y geH+h+k
  Rsa1.0_15221.1_g00001.1 105 MEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERSP-GGQIVDTVYFGEHDHPK 163
                              58****************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.332100164IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.3E-27101164IPR003657WRKY domain
SuperFamilySSF1182903.01E-25101164IPR003657WRKY domain
SMARTSM007741.4E-34105163IPR003657WRKY domain
PfamPF031063.1E-24106162IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MAEVGKVLVS GNSSEAKASD AVVASTDKIE AKPVATVTRT ETEQCPAEIP ESTDSKKLVP  60
ASVSEEEEVV VASDKATKAP ESGTVLSLQS GSEGSSSPFI REKVMEDGYN WRKYGQKLVK  120
GNEFVRSYYR CTHPNCKAKK QLERSPGGQI VDTVYFGEHD HPKPLGGAAA VPINQDRRSD  180
VLTAVSKEKS SGSSSVQTHQ PPKVHGGLHL SVVPMADEVK TAVSPSSRIT TPKDNISPAS  240
KRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-1691164177Probable WRKY transcription factor 4
2lex_A3e-1691164177Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_15221.1_g00001.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9123890.0EU912389.1 Brassica napus WRKY1-1 transcription factor (WRKY1-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018491223.11e-153PREDICTED: WRKY transcription factor 1
SwissprotQ9SI371e-101WRKY1_ARATH; WRKY transcription factor 1
TrEMBLA0A398A3Y41e-133A0A398A3Y4_BRACM; Uncharacterized protein
STRINGBra013187.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.23e-88zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]