PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_12505.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 415aa    MW: 46033.5 Da    PI: 5.9769
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_12505.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.81.5e-30246303259
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              dDg++WrKYGqK+vkg++++rsYY+Ct++ C+vkk+ver aed k++ itY g H+h+
  Rsa1.0_12505.1_g00001.1 246 DDGFRWRKYGQKVVKGNPNARSYYKCTYSACNVKKHVERGAEDVKFLLITYDGIHEHD 303
                              8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.7E-30231305IPR003657WRKY domain
SuperFamilySSF1182906.41E-25240305IPR003657WRKY domain
PROSITE profilePS5081129.482240305IPR003657WRKY domain
SMARTSM007744.3E-33245304IPR003657WRKY domain
PfamPF031061.2E-22246302IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MNAFDGNNIG MTTCWASPSS PSPRTLLAML NQADNNGHVV DQISEIFPQT NHQSEQRSGL  60
RERVAARIEF NLPPLEIQNN RPFAALFRNP SPTVPSPLLL ISPGFSPSAM LQFPNRFFDP  120
THRILPSPVA NGGPPEAVES SGADHAMMKV SNNDPMHVAL PPQQDASFES GPAVNETDVI  180
NMEIERENKD DEEYMEDDHN IVDELDAEPS SPKRSKFGGA TMIGATRSCK SQRVIIQVET  240
EENNPDDGFR WRKYGQKVVK GNPNARSYYK CTYSACNVKK HVERGAEDVK FLLITYDGIH  300
EHDPPAARGS SSSGLKSRYG SSVSQDYNNH QTVRLGRPPS SSQAMRLFPS SLDPPMDMTQ  360
FYMTGLAKLP SLPVNQNHGL MNRNEEPKID RVIPDGTEVF KGIRDRLNLN FGLSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-24236306878Probable WRKY transcription factor 4
2lex_A8e-24236306878Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_12505.1_g00001.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931510.0KM593151.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY65) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018438637.10.0PREDICTED: probable WRKY transcription factor 10
TrEMBLA0A078GLJ10.0A0A078GLJ1_BRANA; BnaC06g11020D protein
STRINGBo6g051390.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102991733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55600.12e-40WRKY DNA-binding protein 10