PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_09279.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 166aa    MW: 19232.3 Da    PI: 7.9363
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_09279.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.61.2e-14354255
                             HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                      HLH  2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                             +++h e+Er+RR+++ s ++ Lr+llP ++   ++K s ++ + +Av+YI++L+
  Rsa1.0_09279.1_g00001.1  3 KMMHREIERQRRQEMASLYASLRSLLPLNF--IQGKRSTSDQVGEAVNYIRYLE 54
                             789*************************75..********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.259153IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.8E-11367IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474597.2E-14369IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.87E-9358No hitNo description
PfamPF000101.3E-11354IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003536.8E-7759IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MEKMMHREIE RQRRQEMASL YASLRSLLPL NFIQGKRSTS DQVGEAVNYI RYLERKIKEL  60
SLRRDELMLL SRGTLLDDSK NEMEAINHVV VRQCLVGVEI VFSSRCCRGQ PQLSSVLQVL  120
SENGLCLRNT ISSIVDDRLI YTIQAEVKDS TLIDLSELEE RLTRMK
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_09279.1_g00001.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009127274.11e-103PREDICTED: transcription factor bHLH36-like
RefseqXP_013674763.11e-103transcription factor bHLH36-like
RefseqXP_013710558.11e-103transcription factor bHLH36-like
SwissprotQ9FLI15e-88BH036_ARATH; Transcription factor bHLH36
TrEMBLA0A078IC521e-102A0A078IC52_BRANA; BnaAnng08070D protein
TrEMBLA0A398ACQ41e-102A0A398ACQ4_BRACM; Uncharacterized protein
TrEMBLA0A3P6A1T71e-102A0A3P6A1T7_BRACM; Uncharacterized protein
TrEMBLM4E1B41e-102M4E1B4_BRARP; Uncharacterized protein
STRINGBra022562.1-P1e-103(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44792754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51780.12e-90bHLH family protein