PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_08460.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 181aa    MW: 20317.9 Da    PI: 7.2159
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_08460.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH36.68.4e-121664555
                             HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                      HLH  5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                              + +E++RR +++s ++eL +llP +  ++   l+  + L +A +YIk+Lq
  Rsa1.0_08460.1_g00002.1 16 RKTIEKNRRIQMKSLYSELNSLLPDQ--TSRAPLTLPDQLDEAANYIKKLQ 64
                             5789*********************7..37777*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000832.13E-6968No hitNo description
SuperFamilySSF474592.14E-101079IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088811.1411163IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.0E-101679IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.0061769IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000107.2E-81764IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0050832Biological Processdefense response to fungus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MDQSPSNTSQ SRSVDRKTIE KNRRIQMKSL YSELNSLLPD QTSRAPLTLP DQLDEAANYI  60
KKLQVNVEKM RERKRKLAAT GSSSMSSSVD VSVARRSPKI EIQETGPILH IFLVTSLEHK  120
FMFHEIIRAV SEESGAEITH AGSSTVDDTV FHTLHCKVED CDYGASGRIS ESLEKLVNHF  180
N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410201e-137AC241020.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039B11, complete sequence.
GenBankAC1728781e-137AC172878.1 Brassica rapa subsp. oleifera cultivar Inbred line 'Chiifu' clone KBrH069E01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137159.11e-115PREDICTED: transcription factor bHLH36-like
RefseqXP_013741406.11e-115PREDICTED: transcription factor bHLH36-like
TrEMBLM4FCH31e-115M4FCH3_BRARP; Uncharacterized protein
STRINGBra038792.1-P1e-114(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12782592
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.18e-86bHLH family protein