PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_08312.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 487aa    MW: 53608.8 Da    PI: 8.1027
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_08312.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.24.9e-16205243240
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              ++k+C+CkkskClk+YCeCfaag++C e C+C dC+Nk 
  Rsa1.0_08312.1_g00002.1 205 SCKRCHCKKSKCLKLYCECFAAGVYCIEPCTCLDCFNKP 243
                              689**********************************96 PP

2TCR52.11.3e-16291329139
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              ++k+gCnC+ks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  Rsa1.0_08312.1_g00002.1 291 RHKRGCNCRKSNCLKKYCECYQSGVGCSINCRCEGCKNA 329
                              589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.3E-19204245IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.584205331IPR005172CRC domain
PfamPF036381.1E-11207242IPR005172CRC domain
SMARTSM011145.0E-17291332IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.1E-12293329IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MFSFCSHIYS SDPSKEVVLV EETLLETVQI LKNDCFSTPT PTPPRAINDG LTDLQRMCDG  60
NVKRKSDTPD WETLFPDTPE LLINDTLNDS EVDRCFLPVS SDSKRRSCGG KKPVSNSKES  120
SADGLHRGVR RRLLDFEMPN IKQTSKDSDV GNEYSLSGNI KAGEAAGQSV VEEVPKSSLD  180
LVVMNQSSPK KKRLKSEQGG EGDSSCKRCH CKKSKCLKLY CECFAAGVYC IEPCTCLDCF  240
NKPIHEETVL ATRKQIESRN PLAFAPKVIG NADSSIMEVG DDASNTPASA RHKRGCNCRK  300
SNCLKKYCEC YQSGVGCSIN CRCEGCKNAF GRKAASSFVG LDIKQDDVSE TAKTQHRAEL  360
FSSVPLPTST PLSLRQPLAQ LPISFNNMLL PQQSQQLHGA SGSSLYEGQS FRKQGMSLFS  420
HSRIETIAED IENVILSPIT NINAVSPNSK RVSLPHLDAS QMTPRRRNGE RKLLLSIPTF  480
PSLTPHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1520732812120Protein lin-54 homolog
5fd3_B2e-1520732812120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_08312.1_g00002.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018489622.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
SwissprotQ8L5481e-170TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A0D3BCT60.0A0A0D3BCT6_BRAOL; Uncharacterized protein
STRINGBo3g081380.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.11e-146Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]