PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_07756.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 376aa    MW: 43014.5 Da    PI: 6.5175
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_07756.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.88.7e-1297139446
                              XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                              +k  rr+++NReAAr+sR+RKka++++Lee   +L++  ++L 
  Rsa1.0_07756.1_g00002.1  97 DKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELE 139
                              7899**************************8888887776554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.3E-794171IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.40496140IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-996140No hitNo description
PfamPF001701.5E-897139IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.91E-798140No hitNo description
PROSITE patternPS000360101116IPR004827Basic-leucine zipper domain
PfamPF141441.4E-30180254IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MMSSFSPTQL ASLRDMGIYE PFQQLVSWGN VYKSDINDHS PNTASSSVIQ VDTRVDDHNN  60
IIKSNYATSP HNQIEAEPSS NDHQDDDCDD DHGKIHDKMK RRLAQNREAA RKSRLRKKAY  120
VQQLEESRLK LSQLEQELEK VKQHGLRVSN SIPSGTIINT RIATFEMEYS HWLEEQSRRV  180
SELRIALQAH ISDIELRMLV ESCLNHYANL FRMKSDAAKA DVFYLISGMW RTSTERFFQW  240
IGGFRPSELL NVVMPYLQPL TDQQVLEVRN LQQSSQQAED ALSQGIEKLQ QSLVENIVVD  300
AVSMDYPPQM AAALENLQAL EGFVNQADHL RQQTLQQMAK ILTTRQAARG LLALGEYLHR  360
LRALSSLWAA RPREPA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAPTransfer from AT1G77920Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_07756.1_g00002.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533840.0AK353384.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-N08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018452469.10.0PREDICTED: transcription factor TGA7
RefseqXP_018452470.10.0PREDICTED: transcription factor TGA7
SwissprotQ93ZE20.0TGA7_ARATH; Transcription factor TGA7
TrEMBLA0A0D3D1G40.0A0A0D3D1G4_BRAOL; Uncharacterized protein
STRINGBo6g121590.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30612766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]