PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_07654.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 1574aa    MW: 177379 Da    PI: 8.3954
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_07654.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.43.3e-29106164159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYG+K+++g++fpr+Y++C+ ++C vkkk+er++++p++v +tYeg+Hnh+
  Rsa1.0_07654.1_g00001.1 106 LDDGYKWRKYGKKPIRGNPFPRHYHKCSNPNCIVKKKIERDTSNPEYVLTTYEGRHNHP 164
                              59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.7E-26101166IPR003657WRKY domain
PROSITE profilePS5081129.08101166IPR003657WRKY domain
SuperFamilySSF1182904.45E-24103166IPR003657WRKY domain
SMARTSM007741.8E-31106165IPR003657WRKY domain
PfamPF031069.6E-21107164IPR003657WRKY domain
PfamPF142445.6E-6190227IPR029472Gag-polypeptide of LTR copia-type
PfamPF142235.2E-24249386No hitNo description
SuperFamilySSF577567.95E-5441479IPR001878Zinc finger, CCHC-type
PfamPF139767.6E-9607672IPR025724GAG-pre-integrase domain
PROSITE profilePS5099419.753683848IPR001584Integrase, catalytic core
Gene3DG3DSA:3.30.420.101.2E-28683841IPR012337Ribonuclease H-like domain
SuperFamilySSF530982.53E-41684842IPR012337Ribonuclease H-like domain
PfamPF006652.6E-21685799IPR001584Integrase, catalytic core
PfamPF077271.7E-8910541295IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
SuperFamilySSF566722.45E-2610821275No hitNo description
SuperFamilySSF566722.45E-2613021484No hitNo description
CDDcd092725.95E-6813791516No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0015074Biological ProcessDNA integration
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1574 aa     Download sequence    Send to blast
MIYPSNINPN FKDFGETFKF DDYDDDAFQM IMEGISLGDH SPTLSWTSSE KLLATEVTSP  60
LQSSLATSPI SLEISEDKDE SKKRKRRKDD QVIHVFKTKS IKEIALDDGY KWRKYGKKPI  120
RGNPFPRHYH KCSNPNCIVK KKIERDTSNP EYVLTTYEGR HNHPSPSVVA MADPNVAYAF  180
PTNLNILHSV TLKLNDGNYL LWKTQFESLL SSQKLIGFVN GVVAAPAQTR TTIEDGVETQ  240
TPNPQYESWF CSDQLVKSWL FGTLSEEVLG YVHNLTTSRE IWLCLAENFN KSSLAREYTL  300
RRNLQLLTNK GKTLSVYVRE FKTLCDSLSS IGKPVDESMK IFGFLNGLGR EFDPITTVIQ  360
SSLMKFPQPT FNDVVSEVQS FEAKLKSYED NTSVNPHLAF TAQGPPTPSA DRTSAPTYNP  420
NYRGRGRGSY RGRGGYSTRG RGFVQHQTQP PNSAERPVCQ ICGKIGHIAL KCYNRFNNAY  480
QNHEAYMGVH VDETGREWYP DSGASAHITS SPHNLQTAHP YAGTDAVMVG DGAYLPVTHV  540
GTGAITTPTG NISLNEVLVC PDIKKSLLSV SKLCDDYPCG IFFDVNNVYV IDIPHQKVIA  600
KGPRSNGLYK LQSTELQAFY SSRQVSASEE VWHHRLAHTS SHTLQLLRTS QAISFNKSKT  660
LPVCEPCQMG KSSRLQFFSS SSLVSEPLGC IHCDLWGPSP VVSNQGFKFY AVFVDECSRF  720
SWFYPLNNKA DFFTVFLGFQ KLVETQYNKK IKILQTDGGG EFVNNRLRQH LLDHGIQHRV  780
SCPYTPQQNG IAERKHRHLI ELGLAMMFQS FLPLHHWVEA FYTASYVSNL LPSPSRNKSP  840
YEILNGTKPD YEHLRVFGST CYPCLRPVAE HKFEPRSLLC VFLGYIPRYK GYRCLYPPTG  900
KVYITRNVIF EESSFPFKEQ YKHLVPRYDT RLLRAWQQAT NPAETAPVEH ISRSLPAPAP  960
QIPATAAAPP VPVPPAAPVI VPPAVVPVQP VPVIQNQHSM MTRAKAGIQK PNSRYALLAS  1020
KYDLKKPRNI REAMAHPIWN NAVTEEITKI HMLHTWSLVP RTPDMNVLSS TWVYTDKINP  1080
DGTQGHPKAR LVAKGFEQEE GLDYLETFSP VVRTATIRLM LKIAVERNWP VKQLDVSSAF  1140
LHGVLSEPVY MFQPDGFTDP QKPDYVCKLT KALYGLKQAP RAWFDTFSEF LLEFGFTCSK  1200
ADPSLFTYHQ QNKTMVLLLY VDDILLTGSD DGLLSALLTA LNSRFAMKDM DSPKYFLGVE  1260
MERNEESIFL HQQAYAKDIL HCASMSDCNP MPTPLPVNID DQRSELFEEP TYYRSLAGKL  1320
QYLTITRPDI QYAVNRVCQH MHAPTCADFA LLKRILRYIK GTLHLGLHIK KNDGLELSAY  1380
CDSDWAGCKE TRRSTTGFCT LLGENLISWS AKRQPTISRS STEAEYRALG ATAQEIAWLS  1440
FLLRDLDVAQ PNATPLMCDN LSAVYLSANP ALHNRSKHFD TDYHYIREQV ALGLIETRHI  1500
SAALQIADIF TKPLARRPFL ELRFKLGVGD PPTSSLRGIN VSENGEVLAQ QALTEAQDKT  1560
EPKRPKLQRS SPSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-211061671778Probable WRKY transcription factor 4
2lex_A1e-211061671778Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18186KKRKRR
28187KKRKRRK
38287KRKRRK
48388RKRRKD
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_07654.1_g00001.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931600.0KM593160.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY92) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ94KV00.0Q94KV0_ARATH; Polyprotein
STRINGBra017773.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21900.13e-51WRKY DNA-binding protein 59