PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_07459.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 202aa    MW: 22778.8 Da    PI: 6.6346
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_07459.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH21.83.4e-0773126154
                              CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                      HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                              +++  n++Er RR r+  ++ +L +llP  s+ ++kK    +i  ++v YI +L
  Rsa1.0_07459.1_g00001.1  73 KKQERNANERLRRLRLHASYLTLGTLLPDHSSSSKKKWCAPSIMDRVVTYIPKL 126
                              67889************************87888899**************887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.35772126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.1E-772146IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.23E-473131No hitNo description
PfamPF000102.6E-473126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.31E-973145IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.5E-478132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MTSFSRFTQA YVNMPNHQDL ASSLLEDLFL HIPAETIGAS GEKNDTCQAQ PERKGKEVVL  60
HVQDAQESSG VAKKQERNAN ERLRRLRLHA SYLTLGTLLP DHSSSSKKKW CAPSIMDRVV  120
TYIPKLHNEV EELTLRKKKL VEEIESKSSR GLSERQDPHI RAISVLELEG SGDEIVVQIV  180
EKPSEGEDYI TVLKNNIIST LY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018460726.11e-128PREDICTED: uncharacterized protein LOC108831696
TrEMBLA0A078ER522e-93A0A078ER52_BRANA; BnaA02g15360D protein
STRINGBra007968.1-P9e-93(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105582234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71200.12e-51bHLH family protein