PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_06364.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GeBP
Protein Properties Length: 161aa    MW: 18081.6 Da    PI: 8.1961
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_06364.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57331.26e-109564897
                   DUF573 48 kvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                              v++ q + Kir+L++K++ +     +g + + s++hd+ +f ls+++Wg
  Rsa1.0_06364.1_g00002.1  9 GVNQIQTIGKIRQLQRKYTSMACS--NGWDWEPSEAHDRTCFALSRQLWG 56
                             48999***************9999..9**********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.5E-71056IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MKTVITTEGV NQIQTIGKIR QLQRKYTSMA CSNGWDWEPS EAHDRTCFAL SRQLWGPNGL  60
FTAAKVGMSA RGPPSSALGD DEDVPGGDLE QQKWFDKSFL VQSIASSSGL DEDTVKLRWS  120
SAPVESKKKI EEMMKALRPK ELAYVSEKAK FMQKLIYENL F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G44810.12e-20DNA-binding storekeeper protein-related transcriptional regulator