PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04403.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 180aa    MW: 20569.1 Da    PI: 10.2415
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04403.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.91.2e-4261136277
                              -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                      SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                              Cqv++C++dl+eak+yhrrhkvCevh+ka++v+++g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++
  Rsa1.0_04403.1_g00002.1  61 CQVDRCTTDLKEAKQYHRRHKVCEVHAKASSVYLAGVKQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKSS 136
                              **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375753.1E-581148IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.109.1E-3356122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.23158135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.37E-3960139IPR004333Transcription factor, SBP-box
PfamPF031101.8E-3261134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MEGKKAQGRG YLKKKASVST YLVDEELEND TDGEEEVGRE EEKRKGAIKG SSSDRVSSRL  60
CQVDRCTTDL KEAKQYHRRH KVCEVHAKAS SVYLAGVKQR FCQQCSRFHE LPEFDEAKRS  120
CRRRLAGHNE RRRKSSGESF GEGSGGRRGL TGQVMQNQER SRVEMTLPKS NTSFKRPQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-4559134984squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0849021e-99AY084902.1 Arabidopsis thaliana clone 12071 mRNA, complete sequence.
GenBankAJ0116321e-99AJ011632.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 4, partial.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013746617.11e-107PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ9S7584e-85SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A078GKE91e-110A0A078GKE9_BRANA; Squamosa promoter-binding-like protein
STRINGBra038101.1-P1e-105(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.24e-65squamosa promoter binding protein-like 4