PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03890.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 141aa    MW: 16347.9 Da    PI: 7.0085
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03890.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.61.3e-4163140178
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                              +Cqve+C+ad+s+ak+yh+rhkvCe+h+kap v +sgl qrfCqqCsrfhel efD++krsCrrrLa+hn+rrr++++
  Rsa1.0_03890.1_g00004.1  63 ACQVERCTADMSRAKQYHKRHKVCEFHAKAPLVRISGLYQRFCQQCSRFHELGEFDDTKRSCRRRLAGHNQRRRRNTT 140
                              5*************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375752.7E-553141IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.4E-3257125IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.52261138IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.02E-3763139IPR004333Transcription factor, SBP-box
PfamPF031101.4E-3164137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MSTRGSKAEG KRILRDMSEE EEENEDTSEE EEDDDEEEEE VALEKKQKGK ATTTTSSSSG  60
TGACQVERCT ADMSRAKQYH KRHKVCEFHA KAPLVRISGL YQRFCQQCSR FHELGEFDDT  120
KRSCRRRLAG HNQRRRRNTT Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3855137284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0054437e-73BT005443.1 Arabidopsis thaliana clone U50647 putative squamosa-promoter binding protein (At2g33810) mRNA, complete cds.
GenBankAK1181797e-73AK118179.1 Arabidopsis thaliana At2g33810 mRNA for putative squamosa-promoter binding protein, complete cds, clone: RAFL19-50-A02.
GenBankY094277e-73Y09427.1 A.thaliana mRNA for squamosa-promoter binding protein like 3.
GenBankAJ2429597e-73AJ242959.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 3 (SPL3 gene).
GenBankAJ0116337e-73AJ011633.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141347.14e-67PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013632192.14e-67PREDICTED: squamosa promoter-binding-like protein 3
SwissprotP930151e-57SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLM4DZD34e-67M4DZD3_BRARP; Squamosa promoter-binding-like protein
STRINGBra021880.1-P1e-66(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-53squamosa promoter binding protein-like 3