PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03486.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 482aa    MW: 52449.1 Da    PI: 8.552
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03486.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1092.2e-34216272259
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              dDgynWrKYGqK+vkgsefprsYY+Ct +gCpvkkkvers  d++v+ei+Y+g+Hnhe
  Rsa1.0_03486.1_g00004.1 216 DDGYNWRKYGQKQVKGSEFPRSYYKCTNPGCPVKKKVERSL-DGQVTEIIYKGQHNHE 272
                              8****************************************.***************8 PP

2WRKY105.62.5e-33379437159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+a+dpk+v++tYeg+Hnh+
  Rsa1.0_03486.1_g00004.1 379 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTQGCGVRKHVERAATDPKAVVTTYEGKHNHD 437
                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-30211274IPR003657WRKY domain
SuperFamilySSF1182902.88E-26214274IPR003657WRKY domain
SMARTSM007746.6E-39215273IPR003657WRKY domain
PfamPF031062.0E-26216272IPR003657WRKY domain
PROSITE profilePS5081124.857216274IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-36364439IPR003657WRKY domain
SuperFamilySSF1182901.1E-29371439IPR003657WRKY domain
PROSITE profilePS5081138.32374439IPR003657WRKY domain
SMARTSM007743.2E-39379438IPR003657WRKY domain
PfamPF031065.5E-26380437IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MSEKEEHRST SKSIGAPSRP SLSLPPRPFS EMFFNAGVGF SPGPMTLVSN MFPESDEFRS  60
FSQLLAGAMA SPAAAASAAA TASEEGNNSS SGDDVDPRFK QSRPTGLTIS QSPSMFTVPP  120
GLSPAMLMDS PSFLGLFSPV QGAYGMTHQQ ALAQVTAQAV QVNANMQPQT EYPTSSQVQS  180
FSSPPDSSLL APRETSNTTI IEQRSQHPLN VDKPADDGYN WRKYGQKQVK GSEFPRSYYK  240
CTNPGCPVKK KVERSLDGQV TEIIYKGQHN HEPPLNTKRG NNNNKDSILS GTSVNNNSFN  300
KSKREQHEAA SQATTEQTSE ASDSEEVGNA ESGVREKAED ERDPKKVRVS EPAAAVSTSH  360
RTVTEPKIIV QTTSEVDLLD DGYRWRKYGQ KVVKGNPYPR SYYKCTTQGC GVRKHVERAA  420
TDPKAVVTTY EGKHNHDLPA SKSSSHAAAA AAQLRPENRH GGLANLNQQP VARLRLKEEH  480
II
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-45216440878Probable WRKY transcription factor 4
2lex_A3e-45216440878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_03486.1_g00004.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931610.0KM593161.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY94) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018433071.10.0PREDICTED: probable WRKY transcription factor 4 isoform X1
SwissprotQ9XI900.0WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLM4EDK90.0M4EDK9_BRARP; Uncharacterized protein
STRINGBra026869.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.10.0WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]