PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03437.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 486aa    MW: 53421.1 Da    PI: 7.9018
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03437.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.3e-32166223260
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                              +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkve s  +++++ei+Y+g+Hnh+k
  Rsa1.0_03437.1_g00004.1 166 EDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVEMSL-EGQITEIVYKGSHNHPK 223
                              7****************************************.***************85 PP

2WRKY105.92e-33326384159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  Rsa1.0_03437.1_g00004.1 326 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTTGCPVRKHVERASHDMRAVITTYEGKHNHD 384
                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.1E-27160224IPR003657WRKY domain
SuperFamilySSF1182905.49E-24165224IPR003657WRKY domain
SMARTSM007744.0E-33165223IPR003657WRKY domain
PfamPF031062.5E-24166222IPR003657WRKY domain
PROSITE profilePS5081121.987166224IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.2E-37311386IPR003657WRKY domain
SuperFamilySSF1182902.22E-29318386IPR003657WRKY domain
PROSITE profilePS5081138.595321386IPR003657WRKY domain
SMARTSM007745.5E-39326385IPR003657WRKY domain
PfamPF031068.1E-26327384IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MAASSLLTMD NNRTTRQNMN GSVNWSQQTP RTLEDLEIPP KFRSFAPSSI STSPSTCFSP  60
SVFLDSPAFV SSSANVLASP TTGALITNES NKKSIAEEEK TNNNNNSLSL FDFSFQTQSS  120
GLSAPTTTTK TTTNSSVLQW SQTDTRPSNN THQSVPYNGR EQRKGEDGYN WRKYGQKQVK  180
GSENPRSYYK CTFPSCPTKK KVEMSLEGQI TEIVYKGSHN HPKPQSTRRS SSSSSSTFHS  240
AVFNAGLDHH GSSDSFAIQQ EDNTTSGSLG DDELSVVSRD EEDCGSEPEA KRWKGENETN  300
GGNGNGSKTV REPRIVVQTT SDIDILDDGY RWRKYGQKVV KGNPNPRSYY KCTTTGCPVR  360
KHVERASHDM RAVITTYEGK HNHDVPAARG SGYTTNRLAH DPSSAPIRPN AIAAHSNYTT  420
SQAPYTLQMM HNNNNNTNPG PFGYAMNNNN NNIQTQQNNF GGGGFSIAKE EPNEESSSSF  480
FDSFLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-38166387878Probable WRKY transcription factor 4
2lex_A7e-38166387878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931480.0KM593148.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY54) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141743.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P50.0WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A078G1810.0A0A078G181_BRANA; BnaA04g22040D protein
STRINGBra017117.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.10.0WRKY DNA-binding protein 33