PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03168.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family BES1
Protein Properties Length: 333aa    MW: 35856.1 Da    PI: 8.2154
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03168.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822152.33.6e-4721631149
                   DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.......... 76 
                              ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+D   +   +             
  Rsa1.0_03168.1_g00005.1   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDVSEHDLTCAGAfpgsycfanv 87 
                              5899*************************************************************999995554443323322112 PP

                   DUF822  77 .eeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                                + +    ++s++p+  +  + + ++ +  + +   sp ss+f+sp+s+++++l+s   +sl+p+l++ls++sss
  Rsa1.0_03168.1_g00005.1  88 fLARSLKSMFKSREPSPMIFCRGQGCSRPVERMEIGGSPCSSNFMSPASSSFANLTSGdgQSLIPWLKHLSTTSSS 163
                              2223333334444444444466677778888888899************99999998788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.7E-453158IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEPDVSEH DLTCAGAFPG SYCFANVFLA RSLKSMFKSR EPSPMIFCRG QGCSRPVERM  120
EIGGSPCSSN FMSPASSSFA NLTSGDGQSL IPWLKHLSTT SSSSASSSSR LPNNYLYISG  180
GSISAPVTPP LSSPTTSRGM NQINNPFFVS STPPSPTRHH QTVPDSEWFS GIQLAQSVPA  240
SPTFSLVSQN PFGFKEAGGG GGSRMWTPGQ SGTCSPAIQT GDVPMSEAVV APPPEFAFGS  300
NANGLVKAWE GERIHEVSGS DDLELTLGNS STR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128310.11e-150PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV881e-138BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLM4CVY11e-150M4CVY1_BRARP; Uncharacterized protein
STRINGBra008378.1-P1e-150(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-110BES1/BZR1 homolog 4