PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03141.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 560aa    MW: 61214.1 Da    PI: 6.1314
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03141.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.52e-31185242260
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                              dDgynWrKYGqK vkgse+prsYY+Ct+++C+vkkkvers+ +++++ei+Y  +Hnh+k
  Rsa1.0_03141.1_g00003.1 185 DDGYNWRKYGQKLVKGSEYPRSYYKCTHPNCEVKKKVERSR-EGHITEIIYAKNHNHPK 242
                              8****************************************.***************85 PP

2WRKY99.62e-31363420259
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              +Dgy+WrKYGqK+vkg+++prsYY+Ct +gC v+k+ver+++d + v +tY g+H+he
  Rsa1.0_03141.1_g00003.1 363 EDGYRWRKYGQKVVKGNPNPRSYYKCTANGCIVTKHVERASDDLTSVLTTYIGKHTHE 420
                              8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.537179243IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.2E-28179243IPR003657WRKY domain
SuperFamilySSF1182903.92E-25182243IPR003657WRKY domain
SMARTSM007742.6E-33184242IPR003657WRKY domain
PfamPF031066.0E-24185241IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-33347422IPR003657WRKY domain
SuperFamilySSF1182909.81E-28354422IPR003657WRKY domain
PROSITE profilePS5081134.176357422IPR003657WRKY domain
SMARTSM007742.7E-35362421IPR003657WRKY domain
PfamPF031065.9E-24363420IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009555Biological Processpollen development
GO:0009846Biological Processpollen germination
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MKRLSPKLKL NLGLVMAGFS NNLAVLGEWR DCSPNQRKRS KAELDREVSL EEDVKDDKDF  60
LQTMFQEKPC CYSRGGLSER IAARSGFNVP TSINTESSTL GSLCLNISSP GVSPASLLES  120
PVFLSNPLLS PTTGKLSYLP SDHKAKDEFF DPTTIGLEPD DSQAYEQTHD IGLGDSMASS  180
GAPADDGYNW RKYGQKLVKG SEYPRSYYKC THPNCEVKKK VERSREGHIT EIIYAKNHNH  240
PKPSPNRRSG IGSSGTCNDM QLDGTEQQES FAGTDENVEW TSPVSHSGSM QVQSGTQFGY  300
GDAAFFNVEG EEERTSHMSL SIGGNGEADE SEPKRRKLEA CASRTTREPK VVLQTTSDID  360
ILEDGYRWRK YGQKVVKGNP NPRSYYKCTA NGCIVTKHVE RASDDLTSVL TTYIGKHTHE  420
VPAARNNSSH LSPGSSGTIP GGLATQTQNH QVHYPVPHSS SEGMVTANSS LFDFQTPMRP  480
PPWAGFSAYG GETELLGLSI SGLAIGQERF TGLPTPAIGD TAEMMLQLPA EPKVEPVSQQ  540
ELGLSRSSLI YSDMSRLPQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-30185423878Probable WRKY transcription factor 4
2lex_A4e-30185423878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_03141.1_g00003.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018470912.10.0PREDICTED: probable WRKY transcription factor 34
SwissprotO655900.0WRK34_ARATH; Probable WRKY transcription factor 34
TrEMBLA0A3N6QWZ40.0A0A3N6QWZ4_BRACR; Uncharacterized protein
STRINGBra026438.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141811524
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.10.0WRKY DNA-binding protein 34
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Hu X, et al.
    Proteasome-mediated degradation of FRIGIDA modulates flowering time in Arabidopsis during vernalization.
    Plant Cell, 2014. 26(12): p. 4763-81
    [PMID:25538183]
  3. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]