PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02929.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family BES1
Protein Properties Length: 346aa    MW: 37259.5 Da    PI: 7.3703
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02929.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822163.71.1e-50280179
                   DUF822  1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleea 79
                             ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrk sk ++ +
  Rsa1.0_02929.1_g00001.1  2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWTVEPDGTTYRKVSKNPSPM 80
                             5899*******************************************************************99988544 PP

2DUF82230.21.6e-0910417772149
                   DUF822  72 gskpl.eeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa...asllpvlsvlslvsss 149
                              g++++ e+++++g sa+asp+ss+q        +s ++sy++sp ss+f+spss+++++l+     +sl+p+l++ls+++ss
  Rsa1.0_02929.1_g00001.1 104 GCSRPiERMDIGGGSATASPCSSYQ--------PSTCASYNPSPGSSNFMSPSSSSFANLTFGdghQSLMPWLKHLSTTTSS 177
                              677777*******************........9********************9999887557789*********997766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056877.2E-593172IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WTVEPDGTTY RKVSKNPSPM TDNLWGQVPP WLKSILNYLD LADGCSRPIE RMDIGGGSAT  120
ASPCSSYQPS TCASYNPSPG SSNFMSPSSS SFANLTFGDG HQSLMPWLKH LSTTTSSSSA  180
SSSSRLPNYL YIPGGSISAP VTPPFSSPTA STLTMNPFFV SSTPPSPTRQ TIPESEWFSG  240
IELAQSVPAS PTFSLVSQTP FGFKEAAGRG GSRMWTPGQS GTCSPAIITP GADQTSDVPM  300
SEAATPPEFV FGSNTNGLVK AWEGERIHVE SGSDDLELTL GNSSTR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF9K201e-95AC005679.1 Arabidopsis thaliana chromosome 1 BAC F9K20 sequence, complete sequence.
GenBankCP0026841e-95CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAY0903311e-95AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0504301e-95AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565187.11e-162BES1/BZR1 homolog 4
SwissprotQ9ZV881e-164BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLD7KVU21e-159D7KVU2_ARALL; Putative uncharacterized protein
STRINGAT1G78700.11e-162(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-145BES1/BZR1 homolog 4